Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 4556244..4557054 | Replicon | chromosome |
Accession | NZ_CP097079 | ||
Organism | Klebsiella pneumoniae strain KP131 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A060VJ83 |
Locus tag | M3I83_RS22030 | Protein ID | WP_004178461.1 |
Coordinates | 4556244..4556777 (-) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | J2E9Q7 |
Locus tag | M3I83_RS22035 | Protein ID | WP_002887278.1 |
Coordinates | 4556788..4557054 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3I83_RS22025 (4555075) | 4555075..4556196 | + | 1122 | WP_020804439.1 | cupin domain-containing protein | - |
M3I83_RS22030 (4556244) | 4556244..4556777 | - | 534 | WP_004178461.1 | type II toxin-antitoxin system toxin KacT | Toxin |
M3I83_RS22035 (4556788) | 4556788..4557054 | - | 267 | WP_002887278.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
M3I83_RS22040 (4557157) | 4557157..4558590 | - | 1434 | WP_020804438.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
M3I83_RS22045 (4558580) | 4558580..4559263 | - | 684 | WP_020804437.1 | copper response regulator transcription factor CusR | - |
M3I83_RS22050 (4559435) | 4559435..4560820 | + | 1386 | WP_020804440.1 | efflux transporter outer membrane subunit | - |
M3I83_RS22055 (4560838) | 4560838..4561182 | + | 345 | WP_002887266.1 | cation efflux system protein CusF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19810.65 Da Isoelectric Point: 5.2614
>T244740 WP_004178461.1 NZ_CP097079:c4556777-4556244 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A060VJ83 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 5ZGN | |
AlphaFold DB | A0A0H3GLZ1 |