Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3957086..3957705 | Replicon | chromosome |
| Accession | NZ_CP097079 | ||
| Organism | Klebsiella pneumoniae strain KP131 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | M3I83_RS19150 | Protein ID | WP_002892050.1 |
| Coordinates | 3957487..3957705 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | M3I83_RS19145 | Protein ID | WP_002892066.1 |
| Coordinates | 3957086..3957460 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3I83_RS19135 (3952238) | 3952238..3953431 | + | 1194 | WP_004177236.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| M3I83_RS19140 (3953454) | 3953454..3956600 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| M3I83_RS19145 (3957086) | 3957086..3957460 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| M3I83_RS19150 (3957487) | 3957487..3957705 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| M3I83_RS19155 (3957864) | 3957864..3958430 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| M3I83_RS19160 (3958402) | 3958402..3958542 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| M3I83_RS19165 (3958563) | 3958563..3959033 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| M3I83_RS19170 (3959008) | 3959008..3960459 | - | 1452 | WP_004177237.1 | PLP-dependent aminotransferase family protein | - |
| M3I83_RS19175 (3960560) | 3960560..3961258 | + | 699 | WP_004177238.1 | GNAT family protein | - |
| M3I83_RS19180 (3961255) | 3961255..3961395 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| M3I83_RS19185 (3961395) | 3961395..3961658 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T244739 WP_002892050.1 NZ_CP097079:3957487-3957705 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT244739 WP_002892066.1 NZ_CP097079:3957086-3957460 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |