Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3957086..3957705 Replicon chromosome
Accession NZ_CP097079
Organism Klebsiella pneumoniae strain KP131

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag M3I83_RS19150 Protein ID WP_002892050.1
Coordinates 3957487..3957705 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag M3I83_RS19145 Protein ID WP_002892066.1
Coordinates 3957086..3957460 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3I83_RS19135 (3952238) 3952238..3953431 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
M3I83_RS19140 (3953454) 3953454..3956600 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
M3I83_RS19145 (3957086) 3957086..3957460 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
M3I83_RS19150 (3957487) 3957487..3957705 + 219 WP_002892050.1 HHA domain-containing protein Toxin
M3I83_RS19155 (3957864) 3957864..3958430 + 567 WP_002892030.1 maltose O-acetyltransferase -
M3I83_RS19160 (3958402) 3958402..3958542 - 141 WP_004147370.1 hypothetical protein -
M3I83_RS19165 (3958563) 3958563..3959033 + 471 WP_002892026.1 YlaC family protein -
M3I83_RS19170 (3959008) 3959008..3960459 - 1452 WP_004177237.1 PLP-dependent aminotransferase family protein -
M3I83_RS19175 (3960560) 3960560..3961258 + 699 WP_004177238.1 GNAT family protein -
M3I83_RS19180 (3961255) 3961255..3961395 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
M3I83_RS19185 (3961395) 3961395..3961658 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T244739 WP_002892050.1 NZ_CP097079:3957487-3957705 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT244739 WP_002892066.1 NZ_CP097079:3957086-3957460 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References