Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 811253..811910 | Replicon | chromosome |
Accession | NZ_CP097079 | ||
Organism | Klebsiella pneumoniae strain KP131 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | M3I83_RS04025 | Protein ID | WP_002916310.1 |
Coordinates | 811500..811910 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | M3I83_RS04020 | Protein ID | WP_002916312.1 |
Coordinates | 811253..811519 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3I83_RS03995 (806896) | 806896..807582 | - | 687 | WP_131079352.1 | MurR/RpiR family transcriptional regulator | - |
M3I83_RS04000 (807616) | 807616..808584 | + | 969 | WP_004225014.1 | IS5 family transposase | - |
M3I83_RS04005 (808739) | 808739..809050 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
M3I83_RS04010 (809214) | 809214..809873 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
M3I83_RS04015 (810024) | 810024..811007 | - | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
M3I83_RS04020 (811253) | 811253..811519 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
M3I83_RS04025 (811500) | 811500..811910 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
M3I83_RS04030 (811917) | 811917..812438 | - | 522 | WP_002916308.1 | flavodoxin FldB | - |
M3I83_RS04035 (812539) | 812539..813435 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
M3I83_RS04040 (813458) | 813458..814171 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
M3I83_RS04045 (814177) | 814177..815910 | + | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 807661..808584 | 923 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T244733 WP_002916310.1 NZ_CP097079:811500-811910 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |