Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 193569..194305 | Replicon | plasmid pKP133-1 |
| Accession | NZ_CP097077 | ||
| Organism | Klebsiella pneumoniae strain KP133 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A2J5Q928 |
| Locus tag | M3I84_RS26280 | Protein ID | WP_004098919.1 |
| Coordinates | 193569..194051 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A7D3T1D0 |
| Locus tag | M3I84_RS26285 | Protein ID | WP_004213599.1 |
| Coordinates | 194039..194305 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3I84_RS26260 (M3I84_26230) | 188923..190269 | + | 1347 | WP_011154555.1 | dihydroorotase | - |
| M3I84_RS26265 (M3I84_26235) | 190333..191355 | + | 1023 | WP_131079334.1 | porphobilinogen synthase | - |
| M3I84_RS26270 (M3I84_26240) | 191530..191925 | + | 396 | Protein_214 | IS3 family transposase | - |
| M3I84_RS26275 (M3I84_26245) | 191921..193148 | - | 1228 | Protein_215 | IS3 family transposase | - |
| M3I84_RS26280 (M3I84_26250) | 193569..194051 | - | 483 | WP_004098919.1 | GNAT family N-acetyltransferase | Toxin |
| M3I84_RS26285 (M3I84_26255) | 194039..194305 | - | 267 | WP_004213599.1 | DUF1778 domain-containing protein | Antitoxin |
| M3I84_RS26290 (M3I84_26260) | 194500..194730 | - | 231 | WP_004213598.1 | hypothetical protein | - |
| M3I84_RS26295 (M3I84_26265) | 194744..194947 | - | 204 | WP_004213596.1 | HHA domain-containing protein | - |
| M3I84_RS26300 (M3I84_26270) | 195008..195502 | - | 495 | WP_004213594.1 | hypothetical protein | - |
| M3I84_RS26305 (M3I84_26275) | 195544..198513 | - | 2970 | WP_004213592.1 | Tn3 family transposase | - |
| M3I84_RS26310 (M3I84_26280) | 198516..199073 | - | 558 | WP_004213590.1 | recombinase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aac(6')-Ib-cr / ARR-3 / blaKPC-2 / dfrA14 | iroB / iroC / iroD / iroN / rmpA / rmpA2 / rmpA / iutA / iucD / iucC / iucB / iucA | 1..296587 | 296587 | |
| - | inside | IScluster/Tn | aac(6')-Ib-cr / ARR-3 / blaKPC-2 | - | 191921..222476 | 30555 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17335.06 Da Isoelectric Point: 10.0704
>T244730 WP_004098919.1 NZ_CP097077:c194051-193569 [Klebsiella pneumoniae]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J5Q928 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7D3T1D0 |