Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 156296..156966 Replicon plasmid pKP133-1
Accession NZ_CP097077
Organism Klebsiella pneumoniae strain KP133

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag M3I84_RS26065 Protein ID WP_004213072.1
Coordinates 156523..156966 (+) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag M3I84_RS26060 Protein ID WP_004213073.1
Coordinates 156296..156526 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3I84_RS26035 (M3I84_26005) 152519..153418 - 900 WP_004225022.1 nucleotide-binding protein -
M3I84_RS26040 (M3I84_26010) 153408..153698 - 291 WP_004213078.1 hypothetical protein -
M3I84_RS26045 (M3I84_26015) 154050..154256 + 207 WP_004213077.1 hypothetical protein -
M3I84_RS26050 (M3I84_26020) 154246..154539 - 294 WP_004213076.1 hypothetical protein -
M3I84_RS26055 (M3I84_26025) 154555..155688 - 1134 WP_004213075.1 DUF3800 domain-containing protein -
M3I84_RS26060 (M3I84_26030) 156296..156526 + 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
M3I84_RS26065 (M3I84_26035) 156523..156966 + 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
M3I84_RS26070 (M3I84_26040) 157115..157366 + 252 WP_186987481.1 hypothetical protein -
M3I84_RS26075 (M3I84_26045) 157389..157693 - 305 Protein_175 transposase -
M3I84_RS26080 (M3I84_26050) 158110..158746 + 637 Protein_176 mucoid phenotype regulator RmpA2 -
M3I84_RS26085 (M3I84_26055) 159264..159667 - 404 Protein_177 GAF domain-containing protein -
M3I84_RS26090 (M3I84_26060) 159758..160678 - 921 WP_004213934.1 DUF1471 domain-containing protein -
M3I84_RS26095 (M3I84_26065) 160727..161218 - 492 WP_011251327.1 DM13 domain-containing protein -
M3I84_RS26100 (M3I84_26070) 161281..161556 - 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aac(6')-Ib-cr / ARR-3 / blaKPC-2 / dfrA14 iroB / iroC / iroD / iroN / rmpA / rmpA2 / rmpA / iutA / iucD / iucC / iucB / iucA 1..296587 296587


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T244729 WP_004213072.1 NZ_CP097077:156523-156966 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT244729 WP_004213073.1 NZ_CP097077:156296-156526 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References