Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 156296..156966 | Replicon | plasmid pKP133-1 |
| Accession | NZ_CP097077 | ||
| Organism | Klebsiella pneumoniae strain KP133 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | Q6U619 |
| Locus tag | M3I84_RS26065 | Protein ID | WP_004213072.1 |
| Coordinates | 156523..156966 (+) | Length | 148 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q6U620 |
| Locus tag | M3I84_RS26060 | Protein ID | WP_004213073.1 |
| Coordinates | 156296..156526 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3I84_RS26035 (M3I84_26005) | 152519..153418 | - | 900 | WP_004225022.1 | nucleotide-binding protein | - |
| M3I84_RS26040 (M3I84_26010) | 153408..153698 | - | 291 | WP_004213078.1 | hypothetical protein | - |
| M3I84_RS26045 (M3I84_26015) | 154050..154256 | + | 207 | WP_004213077.1 | hypothetical protein | - |
| M3I84_RS26050 (M3I84_26020) | 154246..154539 | - | 294 | WP_004213076.1 | hypothetical protein | - |
| M3I84_RS26055 (M3I84_26025) | 154555..155688 | - | 1134 | WP_004213075.1 | DUF3800 domain-containing protein | - |
| M3I84_RS26060 (M3I84_26030) | 156296..156526 | + | 231 | WP_004213073.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| M3I84_RS26065 (M3I84_26035) | 156523..156966 | + | 444 | WP_004213072.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| M3I84_RS26070 (M3I84_26040) | 157115..157366 | + | 252 | WP_186987481.1 | hypothetical protein | - |
| M3I84_RS26075 (M3I84_26045) | 157389..157693 | - | 305 | Protein_175 | transposase | - |
| M3I84_RS26080 (M3I84_26050) | 158110..158746 | + | 637 | Protein_176 | mucoid phenotype regulator RmpA2 | - |
| M3I84_RS26085 (M3I84_26055) | 159264..159667 | - | 404 | Protein_177 | GAF domain-containing protein | - |
| M3I84_RS26090 (M3I84_26060) | 159758..160678 | - | 921 | WP_004213934.1 | DUF1471 domain-containing protein | - |
| M3I84_RS26095 (M3I84_26065) | 160727..161218 | - | 492 | WP_011251327.1 | DM13 domain-containing protein | - |
| M3I84_RS26100 (M3I84_26070) | 161281..161556 | - | 276 | WP_004213932.1 | carboxymuconolactone decarboxylase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aac(6')-Ib-cr / ARR-3 / blaKPC-2 / dfrA14 | iroB / iroC / iroD / iroN / rmpA / rmpA2 / rmpA / iutA / iucD / iucC / iucB / iucA | 1..296587 | 296587 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16006.74 Da Isoelectric Point: 9.3642
>T244729 WP_004213072.1 NZ_CP097077:156523-156966 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|