Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/ElaA-DUF1778 |
| Location | 112753..113504 | Replicon | plasmid pKP133-1 |
| Accession | NZ_CP097077 | ||
| Organism | Klebsiella pneumoniae strain KP133 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | - |
| Locus tag | M3I84_RS25845 | Protein ID | WP_004902249.1 |
| Coordinates | 113022..113504 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | A0A071LPN3 |
| Locus tag | M3I84_RS25840 | Protein ID | WP_004902250.1 |
| Coordinates | 112753..113031 (+) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3I84_RS25805 (M3I84_25775) | 107781..108071 | + | 291 | WP_011154627.1 | MSMEG_0570 family nitrogen starvation response protein | - |
| M3I84_RS25810 (M3I84_25780) | 108089..109354 | + | 1266 | WP_004210292.1 | MSMEG_0569 family flavin-dependent oxidoreductase | - |
| M3I84_RS25815 (M3I84_25785) | 109335..111005 | + | 1671 | WP_004902261.1 | AMP-binding protein | - |
| M3I84_RS25820 (M3I84_25790) | 111089..111199 | - | 111 | Protein_124 | glutathione ABC transporter permease GsiC | - |
| M3I84_RS25825 | 111234..111380 | + | 147 | Protein_125 | DUF2235 domain-containing protein | - |
| M3I84_RS25830 (M3I84_25800) | 111973..112314 | + | 342 | WP_004902257.1 | hypothetical protein | - |
| M3I84_RS25835 (M3I84_25805) | 112422..112634 | + | 213 | WP_266051389.1 | hypothetical protein | - |
| M3I84_RS25840 (M3I84_25810) | 112753..113031 | + | 279 | WP_004902250.1 | DUF1778 domain-containing protein | Antitoxin |
| M3I84_RS25845 (M3I84_25815) | 113022..113504 | + | 483 | WP_004902249.1 | GNAT family N-acetyltransferase | Toxin |
| M3I84_RS25850 (M3I84_25820) | 114539..115078 | + | 540 | WP_004902239.1 | hypothetical protein | - |
| M3I84_RS25855 (M3I84_25825) | 115183..115575 | + | 393 | WP_045145491.1 | hypothetical protein | - |
| M3I84_RS25860 (M3I84_25830) | 115676..116431 | + | 756 | WP_004902235.1 | DUF2971 domain-containing protein | - |
| M3I84_RS25865 (M3I84_25835) | 116458..117105 | + | 648 | WP_014386537.1 | EcsC family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aac(6')-Ib-cr / ARR-3 / blaKPC-2 / dfrA14 | iroB / iroC / iroD / iroN / rmpA / rmpA2 / rmpA / iutA / iucD / iucC / iucB / iucA | 1..296587 | 296587 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17689.52 Da Isoelectric Point: 9.2033
>T244728 WP_004902249.1 NZ_CP097077:113022-113504 [Klebsiella pneumoniae]
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNKVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNKVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|