Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4674794..4675310 | Replicon | chromosome |
Accession | NZ_CP097076 | ||
Organism | Klebsiella pneumoniae strain KP133 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A2A2BGN7 |
Locus tag | M3I84_RS22570 | Protein ID | WP_009486548.1 |
Coordinates | 4674794..4675078 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | M3I84_RS22575 | Protein ID | WP_002886901.1 |
Coordinates | 4675068..4675310 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3I84_RS22545 (4670190) | 4670190..4670453 | - | 264 | WP_004152271.1 | PTS sugar transporter subunit IIB | - |
M3I84_RS22550 (4670583) | 4670583..4670756 | + | 174 | WP_004222159.1 | hypothetical protein | - |
M3I84_RS22555 (4670759) | 4670759..4671502 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
M3I84_RS22560 (4671859) | 4671859..4673997 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
M3I84_RS22565 (4674326) | 4674326..4674790 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
M3I84_RS22570 (4674794) | 4674794..4675078 | - | 285 | WP_009486548.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M3I84_RS22575 (4675068) | 4675068..4675310 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
M3I84_RS22580 (4675388) | 4675388..4677298 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
M3I84_RS22585 (4677321) | 4677321..4678475 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
M3I84_RS22590 (4678542) | 4678542..4679282 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.4951
>T244724 WP_009486548.1 NZ_CP097076:c4675078-4674794 [Klebsiella pneumoniae]
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A2BGN7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |