Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ykfI-yfjZ/CbtA-CbeA
Location 4589141..4589844 Replicon chromosome
Accession NZ_CP097076
Organism Klebsiella pneumoniae strain KP133

Toxin (Protein)


Gene name ykfI Uniprot ID -
Locus tag M3I84_RS22210 Protein ID WP_048261918.1
Coordinates 4589141..4589482 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID -
Locus tag M3I84_RS22215 Protein ID WP_063308407.1
Coordinates 4589503..4589844 (-) Length 114 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M3I84_RS22180 (4584357) 4584357..4585031 + 675 WP_004152211.1 hypothetical protein -
M3I84_RS22185 (4585033) 4585033..4585380 + 348 WP_004199257.1 hypothetical protein -
M3I84_RS22190 (4585383) 4585383..4585862 + 480 WP_002887049.1 type VI secretion system tube protein TssD -
M3I84_RS22195 (4586054) 4586054..4586377 - 324 Protein_4348 hypothetical protein -
M3I84_RS22200 (4586396) 4586396..4587507 - 1112 Protein_4349 IS3 family transposase -
M3I84_RS22205 (4587875) 4587875..4588882 - 1008 WP_038422858.1 restriction endonuclease -
M3I84_RS22210 (4589141) 4589141..4589482 - 342 WP_048261918.1 TA system toxin CbtA family protein Toxin
M3I84_RS22215 (4589503) 4589503..4589844 - 342 WP_063308407.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
M3I84_RS22220 (4589855) 4589855..4590397 - 543 WP_117247367.1 DNA repair protein RadC -
M3I84_RS22225 (4590410) 4590410..4590850 - 441 WP_117247366.1 antirestriction protein -
M3I84_RS22230 (4590882) 4590882..4591703 - 822 WP_117247365.1 DUF932 domain-containing protein -
M3I84_RS22235 (4591804) 4591804..4592034 - 231 WP_131079338.1 DUF905 domain-containing protein -
M3I84_RS22240 (4592106) 4592106..4592555 - 450 WP_117247363.1 IrmA family protein -
M3I84_RS22245 (4592552) 4592552..4593004 - 453 WP_117247362.1 hypothetical protein -
M3I84_RS22250 (4593041) 4593041..4593610 - 570 WP_117247361.1 hypothetical protein -
M3I84_RS22255 (4593610) 4593610..4594314 - 705 WP_014226755.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4585033..4619677 34644


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-109)

Antitoxin

Antitoxin CbeA

(13-111)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 12750.69 Da        Isoelectric Point: 8.0324

>T244723 WP_048261918.1 NZ_CP097076:c4589482-4589141 [Klebsiella pneumoniae]
MKTLPATTPQAATLCLSPVTVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRRGF
NWEEQSPYLRAVDILRARQATGLLKRNRISAAR

Download         Length: 342 bp

Antitoxin


Download         Length: 114 a.a.        Molecular weight: 12722.34 Da        Isoelectric Point: 6.4739

>AT244723 WP_063308407.1 NZ_CP097076:c4589844-4589503 [Klebsiella pneumoniae]
MKSTDSENDSFLQWGLNRNVTPCFGARLVQEGNRLHYLADRASITGKFSEAECLKLDVAFPHFISQMESMLTTGEMNPRH
AHCVTLYHNGFTCEADTLGSCGYVYIAVYPTHR

Download         Length: 342 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References