Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 4556227..4557037 | Replicon | chromosome |
Accession | NZ_CP097076 | ||
Organism | Klebsiella pneumoniae strain KP133 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A060VJ83 |
Locus tag | M3I84_RS22035 | Protein ID | WP_004178461.1 |
Coordinates | 4556227..4556760 (-) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | J2E9Q7 |
Locus tag | M3I84_RS22040 | Protein ID | WP_002887278.1 |
Coordinates | 4556771..4557037 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M3I84_RS22030 (4555058) | 4555058..4556179 | + | 1122 | WP_020804439.1 | cupin domain-containing protein | - |
M3I84_RS22035 (4556227) | 4556227..4556760 | - | 534 | WP_004178461.1 | type II toxin-antitoxin system toxin KacT | Toxin |
M3I84_RS22040 (4556771) | 4556771..4557037 | - | 267 | WP_002887278.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
M3I84_RS22045 (4557140) | 4557140..4558573 | - | 1434 | WP_020804438.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
M3I84_RS22050 (4558563) | 4558563..4559246 | - | 684 | WP_020804437.1 | copper response regulator transcription factor CusR | - |
M3I84_RS22055 (4559418) | 4559418..4560803 | + | 1386 | WP_020804440.1 | efflux transporter outer membrane subunit | - |
M3I84_RS22060 (4560821) | 4560821..4561165 | + | 345 | WP_002887266.1 | cation efflux system protein CusF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19810.65 Da Isoelectric Point: 5.2614
>T244722 WP_004178461.1 NZ_CP097076:c4556760-4556227 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A060VJ83 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 5ZGN | |
AlphaFold DB | A0A0H3GLZ1 |