Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 811252..811909 | Replicon | chromosome |
| Accession | NZ_CP097076 | ||
| Organism | Klebsiella pneumoniae strain KP133 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | W8UCT0 |
| Locus tag | M3I84_RS04025 | Protein ID | WP_002916310.1 |
| Coordinates | 811499..811909 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | M3I84_RS04020 | Protein ID | WP_002916312.1 |
| Coordinates | 811252..811518 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M3I84_RS03995 (806895) | 806895..807581 | - | 687 | WP_131079352.1 | MurR/RpiR family transcriptional regulator | - |
| M3I84_RS04000 (807615) | 807615..808583 | + | 969 | WP_004225014.1 | IS5 family transposase | - |
| M3I84_RS04005 (808738) | 808738..809049 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
| M3I84_RS04010 (809213) | 809213..809872 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
| M3I84_RS04015 (810023) | 810023..811006 | - | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
| M3I84_RS04020 (811252) | 811252..811518 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| M3I84_RS04025 (811499) | 811499..811909 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
| M3I84_RS04030 (811916) | 811916..812437 | - | 522 | WP_002916308.1 | flavodoxin FldB | - |
| M3I84_RS04035 (812538) | 812538..813434 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| M3I84_RS04040 (813457) | 813457..814170 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| M3I84_RS04045 (814176) | 814176..815909 | + | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 807660..808583 | 923 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T244715 WP_002916310.1 NZ_CP097076:811499-811909 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GSW7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |