Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 48142..48724 | Replicon | plasmid pAT40a-b |
Accession | NZ_CP097071 | ||
Organism | Enterococcus faecalis strain AT40a |
Toxin (Protein)
Gene name | zeta | Uniprot ID | A0A0M2AE74 |
Locus tag | M2912_RS13830 | Protein ID | WP_002355414.1 |
Coordinates | 48416..48724 (+) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | Q9AL19 |
Locus tag | M2912_RS13825 | Protein ID | WP_002326825.1 |
Coordinates | 48142..48414 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2912_RS13795 (M2912_13795) | 43265..43618 | + | 354 | WP_283162988.1 | DUF805 domain-containing protein | - |
M2912_RS13800 (M2912_13800) | 43671..44183 | + | 513 | WP_002387940.1 | transposase | - |
M2912_RS13805 (M2912_13805) | 44180..45217 | + | 1038 | WP_002303110.1 | IS3 family transposase | - |
M2912_RS13815 (M2912_13815) | 46985..47839 | + | 855 | WP_248868129.1 | ParA family protein | - |
M2912_RS13820 (M2912_13820) | 47910..48125 | + | 216 | WP_002355411.1 | peptide-binding protein | - |
M2912_RS13825 (M2912_13825) | 48142..48414 | + | 273 | WP_002326825.1 | antitoxin | Antitoxin |
M2912_RS13830 (M2912_13830) | 48416..48724 | + | 309 | WP_002355414.1 | zeta toxin family protein | Toxin |
M2912_RS13835 (M2912_13835) | 48804..49226 | - | 423 | WP_080005963.1 | tyrosine-type recombinase/integrase | - |
M2912_RS13840 (M2912_13840) | 49277..49777 | - | 501 | WP_002355415.1 | HAD family hydrolase | - |
M2912_RS13845 (M2912_13845) | 49782..50549 | - | 768 | WP_002355416.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
M2912_RS13850 (M2912_13850) | 51037..51462 | + | 426 | WP_002355418.1 | galactose-6-phosphate isomerase subunit LacA | - |
M2912_RS13855 (M2912_13855) | 51479..51994 | + | 516 | WP_002345825.1 | galactose-6-phosphate isomerase subunit LacB | - |
M2912_RS13860 (M2912_13860) | 52005..52937 | + | 933 | WP_002363040.1 | tagatose-6-phosphate kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | prgB/asc10 / bsh | 1..76993 | 76993 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11525.91 Da Isoelectric Point: 5.7251
>T244711 WP_002355414.1 NZ_CP097071:48416-48724 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKHATSYSNQLVKLN
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2AE74 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2AF93 |