Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 69769..70340 | Replicon | plasmid pAT40a-a |
| Accession | NZ_CP097070 | ||
| Organism | Enterococcus faecalis strain AT40a | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | S4H3R9 |
| Locus tag | M2912_RS13485 | Protein ID | WP_010784114.1 |
| Coordinates | 69769..70110 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R3KHK9 |
| Locus tag | M2912_RS13490 | Protein ID | WP_002362431.1 |
| Coordinates | 70110..70340 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2912_RS13465 (M2912_13465) | 65168..66451 | - | 1284 | WP_002405123.1 | hypothetical protein | - |
| M2912_RS13475 (M2912_13475) | 67852..68454 | - | 603 | WP_002362434.1 | Fic family protein | - |
| M2912_RS13480 (M2912_13480) | 68719..69657 | - | 939 | WP_002362433.1 | hypothetical protein | - |
| M2912_RS13485 (M2912_13485) | 69769..70110 | - | 342 | WP_010784114.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| M2912_RS13490 (M2912_13490) | 70110..70340 | - | 231 | WP_002362431.1 | hypothetical protein | Antitoxin |
| M2912_RS13495 (M2912_13495) | 70544..71164 | + | 621 | WP_002367784.1 | recombinase family protein | - |
| M2912_RS13500 (M2912_13500) | 71154..71468 | + | 315 | WP_002367785.1 | hypothetical protein | - |
| M2912_RS13505 (M2912_13505) | 71462..71668 | + | 207 | WP_002367786.1 | hypothetical protein | - |
| M2912_RS13510 (M2912_13510) | 71828..72022 | + | 195 | WP_002367787.1 | hypothetical protein | - |
| M2912_RS13515 (M2912_13515) | 72034..72225 | + | 192 | WP_002367788.1 | hypothetical protein | - |
| M2912_RS13520 (M2912_13520) | 72395..72610 | + | 216 | WP_002367791.1 | leucocin A/sakacin P family class II bacteriocin | - |
| M2912_RS13525 (M2912_13525) | 72611..72952 | + | 342 | WP_002367792.1 | bacteriocin immunity protein | - |
| M2912_RS13530 (M2912_13530) | 73368..73886 | + | 519 | WP_002367793.1 | hypothetical protein | - |
| M2912_RS13535 (M2912_13535) | 73834..74049 | + | 216 | WP_002415356.1 | hypothetical protein | - |
| M2912_RS13540 (M2912_13540) | 74141..74227 | + | 87 | WP_012881081.1 | type I toxin-antitoxin system Fst family toxin | - |
| M2912_RS13545 (M2912_13545) | 74484..74780 | + | 297 | WP_002367795.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | cat / tet(L) / tet(M) / erm(B) | - | 1..79433 | 79433 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13270.47 Da Isoelectric Point: 7.9750
>T244709 WP_010784114.1 NZ_CP097070:c70110-69769 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEYLPLKDMAKIDQIIEYIF
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEYLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|