Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 69769..70340 Replicon plasmid pAT40a-a
Accession NZ_CP097070
Organism Enterococcus faecalis strain AT40a

Toxin (Protein)


Gene name mazF Uniprot ID S4H3R9
Locus tag M2912_RS13485 Protein ID WP_010784114.1
Coordinates 69769..70110 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag M2912_RS13490 Protein ID WP_002362431.1
Coordinates 70110..70340 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M2912_RS13465 (M2912_13465) 65168..66451 - 1284 WP_002405123.1 hypothetical protein -
M2912_RS13475 (M2912_13475) 67852..68454 - 603 WP_002362434.1 Fic family protein -
M2912_RS13480 (M2912_13480) 68719..69657 - 939 WP_002362433.1 hypothetical protein -
M2912_RS13485 (M2912_13485) 69769..70110 - 342 WP_010784114.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
M2912_RS13490 (M2912_13490) 70110..70340 - 231 WP_002362431.1 hypothetical protein Antitoxin
M2912_RS13495 (M2912_13495) 70544..71164 + 621 WP_002367784.1 recombinase family protein -
M2912_RS13500 (M2912_13500) 71154..71468 + 315 WP_002367785.1 hypothetical protein -
M2912_RS13505 (M2912_13505) 71462..71668 + 207 WP_002367786.1 hypothetical protein -
M2912_RS13510 (M2912_13510) 71828..72022 + 195 WP_002367787.1 hypothetical protein -
M2912_RS13515 (M2912_13515) 72034..72225 + 192 WP_002367788.1 hypothetical protein -
M2912_RS13520 (M2912_13520) 72395..72610 + 216 WP_002367791.1 leucocin A/sakacin P family class II bacteriocin -
M2912_RS13525 (M2912_13525) 72611..72952 + 342 WP_002367792.1 bacteriocin immunity protein -
M2912_RS13530 (M2912_13530) 73368..73886 + 519 WP_002367793.1 hypothetical protein -
M2912_RS13535 (M2912_13535) 73834..74049 + 216 WP_002415356.1 hypothetical protein -
M2912_RS13540 (M2912_13540) 74141..74227 + 87 WP_012881081.1 type I toxin-antitoxin system Fst family toxin -
M2912_RS13545 (M2912_13545) 74484..74780 + 297 WP_002367795.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid cat / tet(L) / tet(M) / erm(B) - 1..79433 79433


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(7-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13270.47 Da        Isoelectric Point: 7.9750

>T244709 WP_010784114.1 NZ_CP097070:c70110-69769 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEYLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT244709 WP_002362431.1 NZ_CP097070:c70340-70110 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S4H3R9

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References