Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 2637230..2637801 | Replicon | chromosome |
Accession | NZ_CP097069 | ||
Organism | Enterococcus faecalis strain AT40a |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | M2912_RS12685 | Protein ID | WP_010710856.1 |
Coordinates | 2637230..2637571 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | R3JGB1 |
Locus tag | M2912_RS12690 | Protein ID | WP_002354773.1 |
Coordinates | 2637571..2637801 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2912_RS12680 (2633245) | 2633245..2636859 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
M2912_RS12685 (2637230) | 2637230..2637571 | - | 342 | WP_010710856.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
M2912_RS12690 (2637571) | 2637571..2637801 | - | 231 | WP_002354773.1 | hypothetical protein | Antitoxin |
M2912_RS12695 (2638132) | 2638132..2638347 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
M2912_RS12700 (2638486) | 2638486..2639478 | + | 993 | WP_002394775.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
M2912_RS12705 (2639645) | 2639645..2640283 | - | 639 | WP_002378863.1 | lytic polysaccharide monooxygenase | - |
M2912_RS12710 (2640968) | 2640968..2642584 | + | 1617 | WP_010710855.1 | phosphatase PAP2/LCP family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13177.47 Da Isoelectric Point: 9.3988
>T244702 WP_010710856.1 NZ_CP097069:c2637571-2637230 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPIISTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPIISTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|