244698

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ImmA-IrrE/HTH_19(antitoxin)
Location 1654751..1655445 Replicon chromosome
Accession NZ_CP097069
Organism Enterococcus faecalis strain AT40a

Toxin (Protein)


Gene name IrrE Uniprot ID -
Locus tag M2912_RS08130 Protein ID WP_105194759.1
Coordinates 1655101..1655445 (+) Length 115 a.a.

Antitoxin (Protein)


Gene name ImmA Uniprot ID -
Locus tag M2912_RS08125 Protein ID WP_002364355.1
Coordinates 1654751..1655083 (+) Length 111 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M2912_RS08070 (1649870) 1649870..1650070 - 201 WP_057086713.1 hypothetical protein -
M2912_RS08075 (1650067) 1650067..1650210 - 144 WP_226088781.1 hypothetical protein -
M2912_RS08080 (1650279) 1650279..1651190 - 912 WP_105194763.1 YqaJ viral recombinase family protein -
M2912_RS08085 (1651203) 1651203..1651445 - 243 WP_010826713.1 hypothetical protein -
M2912_RS08090 (1651447) 1651447..1652643 - 1197 WP_016626781.1 DEAD/DEAH box helicase -
M2912_RS08095 (1652633) 1652633..1652926 - 294 WP_010826715.1 VRR-NUC domain-containing protein -
M2912_RS08100 (1652923) 1652923..1653123 - 201 WP_105194762.1 hypothetical protein -
M2912_RS08105 (1653338) 1653338..1653754 - 417 WP_226088780.1 hypothetical protein -
M2912_RS08110 (1653755) 1653755..1653934 - 180 WP_002395800.1 hypothetical protein -
M2912_RS08115 (1653941) 1653941..1654252 - 312 WP_105194760.1 hypothetical protein -
M2912_RS08120 (1654263) 1654263..1654439 - 177 WP_002364354.1 helix-turn-helix transcriptional regulator -
M2912_RS08125 (1654751) 1654751..1655083 + 333 WP_002364355.1 helix-turn-helix transcriptional regulator Antitoxin
M2912_RS08130 (1655101) 1655101..1655445 + 345 WP_105194759.1 ImmA/IrrE family metallo-endopeptidase Toxin
M2912_RS08135 (1655479) 1655479..1656207 + 729 WP_033918699.1 potassium channel family protein -
M2912_RS08140 (1656304) 1656304..1657452 + 1149 WP_105194837.1 site-specific integrase -
M2912_RS08145 (1657480) 1657480..1657923 - 444 WP_129992406.1 competence type IV pilus minor pilin ComGD -
M2912_RS08150 (1657920) 1657920..1658195 - 276 WP_002356991.1 competence type IV pilus major pilin ComGC -
M2912_RS08155 (1658195) 1658195..1659241 - 1047 WP_002369171.1 competence type IV pilus assembly protein ComGB -
M2912_RS08160 (1659198) 1659198..1660166 - 969 WP_010710572.1 competence type IV pilus ATPase ComGA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1621833..1657896 36063


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

IrrE N-terminal-like domain

(22-81)

Antitoxin

Cro/C1-type helix-turn-helix domain

(5-63)


Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 13707.58 Da        Isoelectric Point: 5.5339

>T244698 WP_105194759.1 NZ_CP097069:1655101-1655445 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPSERIIFVNQNLSIEEQEESIFHEFKHVVSHSDYMELYKIPSFRNKMEAEADH
HMFKCLIEKHEGQFNYSNVVTHYNLKMGQETYLK

Download         Length: 345 bp

Antitoxin


Download         Length: 111 a.a.        Molecular weight: 12691.16 Da        Isoelectric Point: 4.6307

>AT244698 WP_002364355.1 NZ_CP097069:1654751-1655083 [Enterococcus faecalis]
MNLLERIKKLAKDRDVSIYQLEEEINIGRNTIYQWNKRTPSSDKLEAVANYFNVSVDYLLGRTENPNQAGAKPSDDLDEV
LDNVMSFDGEPLDDHDREVIRAYLKGRFGK

Download         Length: 333 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References