Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 1350461..1351598 | Replicon | chromosome |
Accession | NZ_CP097069 | ||
Organism | Enterococcus faecalis strain AT40a |
Toxin (Protein)
Gene name | zeta | Uniprot ID | - |
Locus tag | M2912_RS06485 | Protein ID | WP_002401483.1 |
Coordinates | 1350461..1351324 (-) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | R2XCR7 |
Locus tag | M2912_RS06490 | Protein ID | WP_000301765.1 |
Coordinates | 1351326..1351598 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2912_RS06455 (1346259) | 1346259..1347026 | - | 768 | WP_002357481.1 | ribonuclease HII | - |
M2912_RS06460 (1347028) | 1347028..1347879 | - | 852 | WP_002357480.1 | ribosome biogenesis GTPase YlqF | - |
M2912_RS06465 (1348155) | 1348155..1348586 | - | 432 | Protein_1242 | ketopantoate reductase C-terminal domain-containing protein | - |
M2912_RS06470 (1348642) | 1348642..1349322 | - | 681 | WP_010710189.1 | IS6-like element IS1216 family transposase | - |
M2912_RS06475 (1349396) | 1349396..1349683 | - | 288 | Protein_1244 | DnaJ domain-containing protein | - |
M2912_RS06480 (1349703) | 1349703..1350020 | - | 318 | WP_002333463.1 | hypothetical protein | - |
M2912_RS06485 (1350461) | 1350461..1351324 | - | 864 | WP_002401483.1 | zeta toxin family protein | Toxin |
M2912_RS06490 (1351326) | 1351326..1351598 | - | 273 | WP_000301765.1 | antitoxin | Antitoxin |
M2912_RS06495 (1351615) | 1351615..1351830 | - | 216 | WP_002295735.1 | peptide-binding protein | - |
M2912_RS06500 (1351929) | 1351929..1352825 | - | 897 | WP_002387620.1 | ParA family protein | - |
M2912_RS06505 (1352928) | 1352928..1353188 | - | 261 | Protein_1250 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
M2912_RS06510 (1353358) | 1353358..1354095 | - | 738 | WP_002292226.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
M2912_RS06515 (1354220) | 1354220..1354315 | - | 96 | WP_001809736.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
M2912_RS06520 (1354384) | 1354384..1354506 | - | 123 | Protein_1253 | peptide-binding protein | - |
M2912_RS06525 (1354626) | 1354626..1356152 | - | 1527 | WP_025191980.1 | type IA DNA topoisomerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | erm(B) / ant(6)-Ia / lnu(B) / lsa(E) / aph(3')-III / aac(6')-aph(2'') | - | 1189036..1410933 | 221897 | |
- | inside | IScluster/Tn | erm(B) / ant(6)-Ia / lnu(B) / lsa(E) / aph(3')-III / aac(6')-aph(2'') | - | 1348642..1379331 | 30689 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32486.06 Da Isoelectric Point: 6.9965
>T244696 WP_002401483.1 NZ_CP097069:c1351324-1350461 [Enterococcus faecalis]
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAILEETQGNVIVIDNDTFKQQHPNFDELA
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSRLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMLQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGL
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAILEETQGNVIVIDNDTFKQQHPNFDELA
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSRLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMLQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGL
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 3Q8X | |
PDB | 1GVN | |
AlphaFold DB | A0A829F0A3 |