Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 47614..48185 Replicon plasmid pAT49a-a
Accession NZ_CP097067
Organism Enterococcus faecalis strain AT49a

Toxin (Protein)


Gene name mazF Uniprot ID A0A2Z2CGM4
Locus tag M2922_RS13350 Protein ID WP_002362432.1
Coordinates 47614..47955 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag M2922_RS13355 Protein ID WP_002362431.1
Coordinates 47955..48185 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M2922_RS13325 (M2922_13305) 42834..44219 + 1386 WP_127821372.1 ISNCY family transposase -
M2922_RS13330 (M2922_13310) 44606..44692 - 87 Protein_47 DUF4180 domain-containing protein -
M2922_RS13335 (M2922_13315) 44747..45427 - 681 WP_127821369.1 IS6 family transposase -
M2922_RS13340 (M2922_13320) 45697..46299 - 603 WP_002362434.1 Fic family protein -
M2922_RS13345 (M2922_13325) 46564..47502 - 939 WP_174115147.1 hypothetical protein -
M2922_RS13350 (M2922_13330) 47614..47955 - 342 WP_002362432.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
M2922_RS13355 (M2922_13335) 47955..48185 - 231 WP_002362431.1 hypothetical protein Antitoxin
M2922_RS13360 (M2922_13340) 48389..49009 + 621 WP_002367784.1 recombinase family protein -
M2922_RS13365 (M2922_13345) 48999..49313 + 315 WP_002367785.1 hypothetical protein -
M2922_RS13370 (M2922_13350) 49307..49513 + 207 WP_002367786.1 hypothetical protein -
M2922_RS13375 (M2922_13355) 49673..49867 + 195 WP_002367787.1 hypothetical protein -
M2922_RS13380 (M2922_13360) 49879..50070 + 192 WP_002367788.1 hypothetical protein -
M2922_RS13385 (M2922_13365) 50240..50455 + 216 WP_002367791.1 leucocin A/sakacin P family class II bacteriocin -
M2922_RS13390 (M2922_13370) 50456..50797 + 342 WP_002367792.1 bacteriocin immunity protein -
M2922_RS13395 (M2922_13375) 51213..51731 + 519 WP_002367793.1 hypothetical protein -
M2922_RS13400 (M2922_13380) 51679..51894 + 216 WP_002415356.1 hypothetical protein -
M2922_RS13405 (M2922_13385) 51986..52072 + 87 WP_012881081.1 type I toxin-antitoxin system Fst family toxin -
M2922_RS13410 (M2922_13390) 52329..52625 + 297 WP_002367795.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid cat / tet(L) / tet(M) / str / Cfr(D) / erm(B) - 1..57278 57278


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(7-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13244.44 Da        Isoelectric Point: 8.0113

>T244692 WP_002362432.1 NZ_CP097067:c47955-47614 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT244692 WP_002362431.1 NZ_CP097067:c48185-47955 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z2CGM4

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References