Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 2656436..2657007 | Replicon | chromosome |
Accession | NZ_CP097066 | ||
Organism | Enterococcus faecalis strain AT49a |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | M2922_RS12625 | Protein ID | WP_174114068.1 |
Coordinates | 2656436..2656777 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | R3JGB1 |
Locus tag | M2922_RS12630 | Protein ID | WP_002354773.1 |
Coordinates | 2656777..2657007 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2922_RS12620 (2652451) | 2652451..2656065 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
M2922_RS12625 (2656436) | 2656436..2656777 | - | 342 | WP_174114068.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
M2922_RS12630 (2656777) | 2656777..2657007 | - | 231 | WP_002354773.1 | hypothetical protein | Antitoxin |
M2922_RS12635 (2657422) | 2657422..2657637 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
M2922_RS12640 (2657776) | 2657776..2658768 | + | 993 | WP_002378862.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
M2922_RS12645 (2658935) | 2658935..2659573 | - | 639 | WP_002378863.1 | lytic polysaccharide monooxygenase | - |
M2922_RS12650 (2660259) | 2660259..2661875 | + | 1617 | WP_174114069.1 | phosphatase PAP2/LCP family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13177.42 Da Isoelectric Point: 8.8678
>T244682 WP_174114068.1 NZ_CP097066:c2656777-2656436 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPIISTIKNIPTRYTLPDDIETHGQVVISQ
LQSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPIISTIKNIPTRYTLPDDIETHGQVVISQ
LQSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|