Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
| Location | 23764..24901 | Replicon | plasmid pAT02-c |
| Accession | NZ_CP097064 | ||
| Organism | Enterococcus faecium strain AT02 | ||
Toxin (Protein)
| Gene name | zeta | Uniprot ID | - |
| Locus tag | M2900_RS13395 | Protein ID | WP_231428275.1 |
| Coordinates | 24038..24901 (+) | Length | 288 a.a. |
Antitoxin (Protein)
| Gene name | epsilon | Uniprot ID | F0EPW7 |
| Locus tag | M2900_RS13390 | Protein ID | WP_005237730.1 |
| Coordinates | 23764..24036 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2900_RS13370 (M2900_13365) | 19679..20296 | + | 618 | WP_126263923.1 | recombinase family protein | - |
| M2900_RS13375 (M2900_13370) | 20296..22440 | + | 2145 | WP_231428277.1 | type IA DNA topoisomerase | - |
| M2900_RS13380 (M2900_13375) | 22543..23439 | + | 897 | WP_231428276.1 | ParA family protein | - |
| M2900_RS13385 (M2900_13380) | 23531..23746 | + | 216 | WP_001835296.1 | peptide-binding protein | - |
| M2900_RS13390 (M2900_13385) | 23764..24036 | + | 273 | WP_005237730.1 | antitoxin | Antitoxin |
| M2900_RS13395 (M2900_13390) | 24038..24901 | + | 864 | WP_231428275.1 | zeta toxin family protein | Toxin |
| M2900_RS13400 (M2900_13395) | 25164..25901 | - | 738 | WP_001038790.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
| M2900_RS13405 (M2900_13400) | 26026..26109 | - | 84 | WP_031929417.1 | 23S rRNA methyltransferase attenuator leader peptide ErmL | - |
| M2900_RS13515 | 26158..26241 | - | 84 | Protein_30 | MLS leader peptide | - |
| M2900_RS13410 (M2900_13405) | 26897..27094 | + | 198 | WP_231415653.1 | hypothetical protein | - |
| M2900_RS13415 (M2900_13410) | 27124..27804 | - | 681 | WP_127821369.1 | IS6 family transposase | - |
| M2900_RS13420 (M2900_13415) | 27878..28468 | + | 591 | Protein_33 | GMP synthase (glutamine-hydrolyzing) | - |
| M2900_RS13425 (M2900_13420) | 28552..29625 | - | 1074 | WP_105459893.1 | 23S rRNA (adenine(2503)-C(8))-methyltransferase Cfr(D) | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | erm(B) / Cfr(D) | - | 1..33236 | 33236 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32418.01 Da Isoelectric Point: 6.9964
>T244664 WP_231428275.1 NZ_CP097064:24038-24901 [Enterococcus faecium]
MANIVNFTDKQFENRLNDNLEELVQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVLNKHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGI
MANIVNFTDKQFENRLNDNLEELVQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVLNKHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGI
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|