Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 454691..455262 | Replicon | chromosome |
Accession | NZ_CP097061 | ||
Organism | Enterococcus faecium strain AT02 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | Q3Y2B8 |
Locus tag | M2900_RS02195 | Protein ID | WP_002286801.1 |
Coordinates | 454921..455262 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A828ZZN9 |
Locus tag | M2900_RS02190 | Protein ID | WP_002323011.1 |
Coordinates | 454691..454921 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2900_RS02165 (M2900_02165) | 450172..451500 | + | 1329 | WP_002327434.1 | FAD-containing oxidoreductase | - |
M2900_RS02170 (M2900_02170) | 451522..452148 | + | 627 | WP_002286816.1 | cysteine hydrolase | - |
M2900_RS02175 (M2900_02175) | 452331..452912 | + | 582 | WP_002327433.1 | TetR/AcrR family transcriptional regulator | - |
M2900_RS02180 (M2900_02180) | 453277..453852 | + | 576 | WP_002352505.1 | SOS response-associated peptidase family protein | - |
M2900_RS02185 (M2900_02185) | 454057..454395 | - | 339 | WP_002306002.1 | hypothetical protein | - |
M2900_RS02190 (M2900_02190) | 454691..454921 | + | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
M2900_RS02195 (M2900_02195) | 454921..455262 | + | 342 | WP_002286801.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
M2900_RS02200 (M2900_02200) | 456112..456297 | + | 186 | WP_002304207.1 | hypothetical protein | - |
M2900_RS02205 (M2900_02205) | 456567..457729 | + | 1163 | WP_142431476.1 | IS3 family transposase | - |
M2900_RS02210 (M2900_02210) | 457860..458102 | + | 243 | Protein_438 | LPXTG cell wall anchor domain-containing protein | - |
M2900_RS02215 (M2900_02215) | 458175..459071 | + | 897 | Protein_439 | class C sortase | - |
M2900_RS02220 (M2900_02220) | 459252..459926 | + | 675 | WP_038811248.1 | response regulator transcription factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13302.68 Da Isoelectric Point: 9.9044
>T244663 WP_002286801.1 NZ_CP097061:454921-455262 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829FD66 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A828ZZN9 |