Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 2741178..2741749 | Replicon | chromosome |
| Accession | NZ_CP097059 | ||
| Organism | Enterococcus faecalis strain AT04 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | M2902_RS13155 | Protein ID | WP_002354774.1 |
| Coordinates | 2741178..2741519 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R3JGB1 |
| Locus tag | M2902_RS13160 | Protein ID | WP_002354773.1 |
| Coordinates | 2741519..2741749 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2902_RS13150 (2737193) | 2737193..2740807 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
| M2902_RS13155 (2741178) | 2741178..2741519 | - | 342 | WP_002354774.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| M2902_RS13160 (2741519) | 2741519..2741749 | - | 231 | WP_002354773.1 | hypothetical protein | Antitoxin |
| M2902_RS13165 (2742156) | 2742156..2742371 | - | 216 | WP_002358974.1 | zinc ribbon domain-containing protein | - |
| M2902_RS13170 (2742510) | 2742510..2743502 | + | 993 | WP_002358973.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| M2902_RS13175 (2743569) | 2743569..2744201 | - | 633 | WP_002358972.1 | RloB family protein | - |
| M2902_RS13180 (2744210) | 2744210..2745505 | - | 1296 | WP_002396787.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13156.40 Da Isoelectric Point: 9.3984
>T244641 WP_002354774.1 NZ_CP097059:c2741519-2741178 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|