Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ImmA-IrrE/HTH_26(antitoxin) |
Location | 2372399..2373094 | Replicon | chromosome |
Accession | NZ_CP097059 | ||
Organism | Enterococcus faecalis strain AT04 |
Toxin (Protein)
Gene name | IrrE | Uniprot ID | - |
Locus tag | M2902_RS11425 | Protein ID | WP_104802092.1 |
Coordinates | 2372750..2373094 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | ImmA | Uniprot ID | - |
Locus tag | M2902_RS11420 | Protein ID | WP_002373919.1 |
Coordinates | 2372399..2372731 (+) | Length | 111 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2902_RS11370 (2367870) | 2367870..2368685 | - | 816 | WP_161972151.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
M2902_RS11375 (2368648) | 2368648..2369613 | - | 966 | WP_002415270.1 | RecT family recombinase | - |
M2902_RS11380 (2369714) | 2369714..2369938 | - | 225 | WP_104802087.1 | hypothetical protein | - |
M2902_RS11385 (2369935) | 2369935..2370234 | - | 300 | WP_002388460.1 | hypothetical protein | - |
M2902_RS11390 (2370301) | 2370301..2370480 | - | 180 | WP_104802088.1 | hypothetical protein | - |
M2902_RS11395 (2370515) | 2370515..2370784 | - | 270 | WP_002365131.1 | hypothetical protein | - |
M2902_RS11400 (2370860) | 2370860..2371174 | + | 315 | WP_010776102.1 | hypothetical protein | - |
M2902_RS14050 (2371155) | 2371155..2371283 | - | 129 | WP_010776103.1 | hypothetical protein | - |
M2902_RS11405 (2371430) | 2371430..2371612 | + | 183 | WP_104802089.1 | hypothetical protein | - |
M2902_RS11410 (2371604) | 2371604..2371906 | - | 303 | WP_104802090.1 | hypothetical protein | - |
M2902_RS11415 (2371919) | 2371919..2372101 | - | 183 | WP_104802091.1 | hypothetical protein | - |
M2902_RS11420 (2372399) | 2372399..2372731 | + | 333 | WP_002373919.1 | helix-turn-helix transcriptional regulator | Antitoxin |
M2902_RS11425 (2372750) | 2372750..2373094 | + | 345 | WP_104802092.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
M2902_RS11430 (2373181) | 2373181..2373363 | + | 183 | WP_010817602.1 | hypothetical protein | - |
M2902_RS11435 (2373365) | 2373365..2374012 | - | 648 | WP_104802093.1 | hypothetical protein | - |
M2902_RS11440 (2374202) | 2374202..2375383 | + | 1182 | WP_010707133.1 | site-specific integrase | - |
M2902_RS11445 (2375486) | 2375486..2375635 | - | 150 | WP_002356321.1 | 50S ribosomal protein L33 | - |
M2902_RS11450 (2375761) | 2375761..2377896 | - | 2136 | WP_002359399.1 | penicillin-binding protein 2 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2342714..2375383 | 32669 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13626.61 Da Isoelectric Point: 5.6177
>T244638 WP_104802092.1 NZ_CP097059:2372750-2373094 [Enterococcus faecalis]
MKSIKELVEEYNVELVFTTLNKRACFDPTYGIIFVNQNLTPSEQEEAIYHELKHVKDHVDIMTLYKIPVFRSKMESEAEQ
YMFRSLIEKYEGQYNYSNVIAHYNLKMGQEVYLK
MKSIKELVEEYNVELVFTTLNKRACFDPTYGIIFVNQNLTPSEQEEAIYHELKHVKDHVDIMTLYKIPVFRSKMESEAEQ
YMFRSLIEKYEGQYNYSNVIAHYNLKMGQEVYLK
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|