Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
| Location | 438618..439755 | Replicon | chromosome |
| Accession | NZ_CP097059 | ||
| Organism | Enterococcus faecalis strain AT04 | ||
Toxin (Protein)
| Gene name | zeta | Uniprot ID | - |
| Locus tag | M2902_RS02195 | Protein ID | WP_032495456.1 |
| Coordinates | 438892..439755 (+) | Length | 288 a.a. |
Antitoxin (Protein)
| Gene name | epsilon | Uniprot ID | R2XCR7 |
| Locus tag | M2902_RS02190 | Protein ID | WP_000301765.1 |
| Coordinates | 438618..438890 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2902_RS02155 (433687) | 433687..435519 | + | 1833 | Protein_401 | DNA topoisomerase | - |
| M2902_RS02160 (435653) | 435653..435892 | + | 240 | WP_002425012.1 | peptide-binding protein | - |
| M2902_RS02165 (435956) | 435956..436024 | + | 69 | WP_011100846.1 | 23S rRNA methyltransferase attenuator leader peptide ErmL | - |
| M2902_RS02170 (436149) | 436149..436886 | + | 738 | WP_032495453.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
| M2902_RS02175 (437056) | 437056..437316 | + | 261 | Protein_405 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
| M2902_RS02180 (437398) | 437398..438294 | + | 897 | WP_002387620.1 | ParA family protein | - |
| M2902_RS02185 (438386) | 438386..438601 | + | 216 | WP_001835296.1 | peptide-binding protein | - |
| M2902_RS02190 (438618) | 438618..438890 | + | 273 | WP_000301765.1 | antitoxin | Antitoxin |
| M2902_RS02195 (438892) | 438892..439755 | + | 864 | WP_032495456.1 | zeta toxin family protein | Toxin |
| M2902_RS02200 (440196) | 440196..440513 | + | 318 | WP_002338433.1 | hypothetical protein | - |
| M2902_RS02205 (441047) | 441047..441544 | + | 498 | WP_010713926.1 | molecular chaperone DnaJ | - |
| M2902_RS02210 (441579) | 441579..441701 | + | 123 | WP_159111623.1 | DpnD/PcfM family protein | - |
| M2902_RS02215 (441755) | 441755..442435 | + | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
| M2902_RS02220 (442480) | 442480..443100 | - | 621 | Protein_414 | MFS transporter | - |
| M2902_RS02225 (443301) | 443301..443711 | - | 411 | WP_231428140.1 | protein rep | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | erm(B) / tet(O/W/32/O) / fexB / optrA | bsh | 401696..504060 | 102364 | |
| - | inside | IScluster/Tn | erm(B) / tet(O/W/32/O) / fexB / optrA | bsh | 436149..485091 | 48942 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32444.13 Da Isoelectric Point: 6.9964
>T244635 WP_032495456.1 NZ_CP097059:438892-439755 [Enterococcus faecalis]
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGIIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLEKELNRKVASKEIQ
PTLERIEQKMILNKHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGI
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGIIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLEKELNRKVASKEIQ
PTLERIEQKMILNKHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGI
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 3Q8X | |
| PDB | 1GVN | |
| AlphaFold DB | A0A829F0A3 |