Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 56412..57549 | Replicon | plasmid pAT09-b |
Accession | NZ_CP097058 | ||
Organism | Enterococcus faecalis strain AT09 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | P0A4M2 |
Locus tag | M2903_RS14345 | Protein ID | WP_002332783.1 |
Coordinates | 56412..57275 (-) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | Q9AL19 |
Locus tag | M2903_RS14350 | Protein ID | WP_002326825.1 |
Coordinates | 57277..57549 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2903_RS14310 (M2903_14310) | 51525..52433 | - | 909 | WP_001255866.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
M2903_RS14315 (M2903_14315) | 52452..52568 | - | 117 | Protein_64 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
M2903_RS14320 (M2903_14320) | 52738..53475 | - | 738 | WP_181710332.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
M2903_RS14325 (M2903_14325) | 53600..53683 | - | 84 | WP_032501549.1 | 23S rRNA methyltransferase attenuator leader peptide ErmL | - |
M2903_RS14445 | 53732..53815 | - | 84 | Protein_67 | MLS leader peptide | - |
M2903_RS14330 (M2903_14330) | 54138..54818 | + | 681 | WP_010710189.1 | IS6-like element IS1216 family transposase | - |
M2903_RS14335 (M2903_14335) | 54852..55358 | - | 507 | WP_002415429.1 | trimethoprim-resistant dihydrofolate reductase DfrG | - |
M2903_RS14340 (M2903_14340) | 55655..55972 | - | 318 | WP_002326830.1 | hypothetical protein | - |
M2903_RS14345 (M2903_14345) | 56412..57275 | - | 864 | WP_002332783.1 | zeta toxin family protein | Toxin |
M2903_RS14350 (M2903_14350) | 57277..57549 | - | 273 | WP_002326825.1 | antitoxin | Antitoxin |
M2903_RS14355 (M2903_14355) | 57567..57782 | - | 216 | WP_001835296.1 | peptide-binding protein | - |
M2903_RS14360 (M2903_14360) | 57874..58770 | - | 897 | WP_002326827.1 | ParA family protein | - |
M2903_RS14365 (M2903_14365) | 58873..59133 | - | 261 | Protein_75 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
M2903_RS14370 (M2903_14370) | 59303..60040 | - | 738 | WP_001038795.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
M2903_RS14375 (M2903_14375) | 60165..60248 | - | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
M2903_RS14450 | 60297..60380 | - | 84 | Protein_78 | MLS leader peptide | - |
M2903_RS14380 (M2903_14380) | 60680..61051 | - | 372 | WP_002358205.1 | hypothetical protein | - |
M2903_RS14385 (M2903_14385) | 61044..61889 | - | 846 | WP_000239313.1 | AAA family ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | cat / tet(L) / tet(M) / str / erm(B) / aph(3')-III / ant(6)-Ia / dfrG | - | 1..62360 | 62360 | |
- | inside | IS/Tn | erm(B) / aph(3')-III / ant(6)-Ia / dfrG | - | 48612..60040 | 11428 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32675.27 Da Isoelectric Point: 7.3939
>T244633 WP_002332783.1 NZ_CP097058:c57275-56412 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | P0A4M2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2AF93 |