Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ImmA-IrrE/HTH_19(antitoxin) |
Location | 129641..130660 | Replicon | chromosome |
Accession | NZ_CP097056 | ||
Organism | Enterococcus faecalis strain AT09 |
Toxin (Protein)
Gene name | IrrE | Uniprot ID | Q839N5 |
Locus tag | M2903_RS00540 | Protein ID | WP_002359283.1 |
Coordinates | 129641..130279 (-) | Length | 213 a.a. |
Antitoxin (Protein)
Gene name | ImmA | Uniprot ID | - |
Locus tag | M2903_RS00545 | Protein ID | WP_002359284.1 |
Coordinates | 130286..130660 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2903_RS00515 (125531) | 125531..126496 | + | 966 | WP_174113897.1 | ornithine cyclodeaminase family protein | - |
M2903_RS00520 (126498) | 126498..127286 | + | 789 | WP_174113896.1 | PhzF family phenazine biosynthesis protein | - |
M2903_RS00525 (127334) | 127334..127879 | - | 546 | WP_002385445.1 | ATP:cob(I)alamin adenosyltransferase | - |
M2903_RS00530 (128030) | 128030..128371 | - | 342 | WP_174113895.1 | hypothetical protein | - |
M2903_RS00535 (129024) | 129024..129599 | + | 576 | WP_002359282.1 | restriction endonuclease | - |
M2903_RS00540 (129641) | 129641..130279 | - | 639 | WP_002359283.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
M2903_RS00545 (130286) | 130286..130660 | - | 375 | WP_002359284.1 | helix-turn-helix domain-containing protein | Antitoxin |
M2903_RS00550 (131502) | 131502..131684 | - | 183 | WP_002359286.1 | hypothetical protein | - |
M2903_RS00555 (131851) | 131851..132102 | + | 252 | WP_002359287.1 | hypothetical protein | - |
M2903_RS00560 (132189) | 132189..132515 | + | 327 | WP_002359288.1 | hypothetical protein | - |
M2903_RS00565 (132515) | 132515..132922 | + | 408 | WP_002359289.1 | DUF961 family protein | - |
M2903_RS00570 (133072) | 133072..133296 | + | 225 | WP_002359290.1 | hypothetical protein | - |
M2903_RS00575 (133325) | 133325..133516 | + | 192 | WP_010773668.1 | hypothetical protein | - |
M2903_RS00580 (133498) | 133498..133902 | + | 405 | WP_002359292.1 | hypothetical protein | - |
M2903_RS00585 (134014) | 134014..134346 | + | 333 | WP_002359293.1 | nucleotidyltransferase domain-containing protein | - |
M2903_RS00590 (134336) | 134336..134719 | + | 384 | WP_002359294.1 | DUF86 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | EF0149 / tufA | 119878..200364 | 80486 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 213 a.a. Molecular weight: 25186.21 Da Isoelectric Point: 9.1676
>T244603 WP_002359283.1 NZ_CP097056:c130279-129641 [Enterococcus faecalis]
MILNKKKLYFETQAFTDKLINEISINMSKRKELINCYDIEAYVKETENIDFFDYPFKKQSKKLIWGSVTKIGDVTMVATA
QHLKIEIKNFTKMHEIIHHYFDYTTDMPNNEKSFDTLLIKKGYLPEDYPKEFRANKGAGMLLINKKALKYAFSTYDDLEK
MASFFNVNDIVLKIRILDELIYSHNLSYKQANLIYNSYYFQQQTQLKEILLK
MILNKKKLYFETQAFTDKLINEISINMSKRKELINCYDIEAYVKETENIDFFDYPFKKQSKKLIWGSVTKIGDVTMVATA
QHLKIEIKNFTKMHEIIHHYFDYTTDMPNNEKSFDTLLIKKGYLPEDYPKEFRANKGAGMLLINKKALKYAFSTYDDLEK
MASFFNVNDIVLKIRILDELIYSHNLSYKQANLIYNSYYFQQQTQLKEILLK
Download Length: 639 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14518.29 Da Isoelectric Point: 4.8896
>AT244603 WP_002359284.1 NZ_CP097056:c130660-130286 [Enterococcus faecalis]
MKTYEKIKQLRENREITQKEISNALDINVSVYNKIELGIRPLREEELTAIADFFNVSIDYLTGRTDNPTTPSNNQKEAGQ
NIISHFRLNTNDLSSDDIEELEKELIDFQEFLIKRAKERKKKSE
MKTYEKIKQLRENREITQKEISNALDINVSVYNKIELGIRPLREEELTAIADFFNVSIDYLTGRTDNPTTPSNNQKEAGQ
NIISHFRLNTNDLSSDDIEELEKELIDFQEFLIKRAKERKKKSE
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|