Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 2746896..2747467 | Replicon | chromosome |
| Accession | NZ_CP097048 | ||
| Organism | Enterococcus faecalis strain AT22 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | M2906_RS13205 | Protein ID | WP_010710856.1 |
| Coordinates | 2746896..2747237 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R3JGB1 |
| Locus tag | M2906_RS13210 | Protein ID | WP_002354773.1 |
| Coordinates | 2747237..2747467 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2906_RS13200 (2742911) | 2742911..2746525 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
| M2906_RS13205 (2746896) | 2746896..2747237 | - | 342 | WP_010710856.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| M2906_RS13210 (2747237) | 2747237..2747467 | - | 231 | WP_002354773.1 | hypothetical protein | Antitoxin |
| M2906_RS13215 (2747798) | 2747798..2748013 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
| M2906_RS13220 (2748152) | 2748152..2749144 | + | 993 | WP_002394775.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| M2906_RS13225 (2749311) | 2749311..2749949 | - | 639 | WP_002378863.1 | lytic polysaccharide monooxygenase | - |
| M2906_RS13230 (2750634) | 2750634..2752250 | + | 1617 | WP_010710855.1 | phosphatase PAP2/LCP family protein | - |
| - (2752334) | 2752334..2752409 | - | 76 | NuclAT_7 | - | - |
| - (2752307) | 2752307..2752423 | - | 117 | NuclAT_10 | - | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13177.47 Da Isoelectric Point: 9.3988
>T244594 WP_010710856.1 NZ_CP097048:c2747237-2746896 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPIISTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPIISTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|