Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
| Location | 52286..53423 | Replicon | plasmid pAT29-a |
| Accession | NZ_CP097047 | ||
| Organism | Enterococcus faecalis strain AT29 | ||
Toxin (Protein)
| Gene name | zeta | Uniprot ID | P0A4M2 |
| Locus tag | M2907_RS13695 | Protein ID | WP_002332783.1 |
| Coordinates | 52286..53149 (-) | Length | 288 a.a. |
Antitoxin (Protein)
| Gene name | epsilon | Uniprot ID | Q9AL19 |
| Locus tag | M2907_RS13700 | Protein ID | WP_002326825.1 |
| Coordinates | 53151..53423 (-) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2907_RS13670 (M2907_13665) | 48612..49349 | - | 738 | WP_181710332.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
| M2907_RS13675 (M2907_13670) | 49474..49557 | - | 84 | WP_032501549.1 | 23S rRNA methyltransferase attenuator leader peptide ErmL | - |
| M2907_RS13790 | 49606..49689 | - | 84 | Protein_60 | MLS leader peptide | - |
| M2907_RS13680 (M2907_13675) | 50012..50692 | + | 681 | WP_010710189.1 | IS6-like element IS1216 family transposase | - |
| M2907_RS13685 (M2907_13680) | 50726..51232 | - | 507 | WP_002415429.1 | trimethoprim-resistant dihydrofolate reductase DfrG | - |
| M2907_RS13690 (M2907_13685) | 51529..51846 | - | 318 | WP_002326830.1 | hypothetical protein | - |
| M2907_RS13695 (M2907_13690) | 52286..53149 | - | 864 | WP_002332783.1 | zeta toxin family protein | Toxin |
| M2907_RS13700 (M2907_13695) | 53151..53423 | - | 273 | WP_002326825.1 | antitoxin | Antitoxin |
| M2907_RS13705 (M2907_13700) | 53441..53656 | - | 216 | WP_001835296.1 | peptide-binding protein | - |
| M2907_RS13710 (M2907_13705) | 53748..54644 | - | 897 | WP_002326827.1 | ParA family protein | - |
| M2907_RS13715 (M2907_13710) | 54726..54986 | - | 261 | Protein_68 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
| M2907_RS13720 (M2907_13715) | 55156..55893 | - | 738 | WP_001038795.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
| M2907_RS13725 (M2907_13720) | 56018..56101 | - | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
| M2907_RS13795 | 56150..56233 | - | 84 | Protein_71 | MLS leader peptide | - |
| M2907_RS13730 (M2907_13725) | 56533..56904 | - | 372 | WP_002358205.1 | hypothetical protein | - |
| M2907_RS13735 (M2907_13730) | 56897..57742 | - | 846 | WP_000239313.1 | AAA family ATPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | cat / tet(L) / tet(M) / str / erm(B) / dfrG | - | 1..58213 | 58213 | |
| - | inside | IS/Tn | erm(B) / dfrG | - | 48612..55893 | 7281 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32675.27 Da Isoelectric Point: 7.3939
>T244585 WP_002332783.1 NZ_CP097047:c53149-52286 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | P0A4M2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M2AF93 |