244584

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 42005..42576 Replicon plasmid pAT29-a
Accession NZ_CP097047
Organism Enterococcus faecalis strain AT29

Toxin (Protein)


Gene name mazF Uniprot ID A0A2Z2CGM4
Locus tag M2907_RS13600 Protein ID WP_002362432.1
Coordinates 42005..42346 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag M2907_RS13605 Protein ID WP_002362431.1
Coordinates 42346..42576 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M2907_RS13580 (M2907_13575) 37506..38354 + 849 WP_001258486.1 streptomycin adenylyltransferase Str -
M2907_RS13590 (M2907_13585) 40088..40690 - 603 WP_002362434.1 Fic family protein -
M2907_RS13595 (M2907_13590) 40955..41893 - 939 WP_174115147.1 hypothetical protein -
M2907_RS13600 (M2907_13595) 42005..42346 - 342 WP_002362432.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
M2907_RS13605 (M2907_13600) 42346..42576 - 231 WP_002362431.1 hypothetical protein Antitoxin
M2907_RS13610 (M2907_13605) 42780..43400 + 621 WP_002367784.1 recombinase family protein -
M2907_RS13615 (M2907_13610) 43390..43704 + 315 WP_002367785.1 hypothetical protein -
M2907_RS13620 (M2907_13615) 43698..43904 + 207 WP_002367786.1 hypothetical protein -
M2907_RS13625 (M2907_13620) 44064..44258 + 195 WP_002367787.1 hypothetical protein -
M2907_RS13630 (M2907_13625) 44270..44461 + 192 WP_002367788.1 hypothetical protein -
M2907_RS13635 (M2907_13630) 44631..44846 + 216 WP_002367791.1 leucocin A/sakacin P family class II bacteriocin -
M2907_RS13640 (M2907_13635) 44847..45188 + 342 WP_002367792.1 bacteriocin immunity protein -
M2907_RS13645 (M2907_13640) 45604..46122 + 519 WP_002367793.1 hypothetical protein -
M2907_RS13650 (M2907_13645) 46070..46285 + 216 WP_002415356.1 hypothetical protein -
M2907_RS13655 (M2907_13650) 46377..46463 + 87 WP_012881081.1 type I toxin-antitoxin system Fst family toxin -
M2907_RS13660 (M2907_13655) 46720..47016 + 297 WP_002367795.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid cat / tet(L) / tet(M) / str / erm(B) / dfrG - 1..58213 58213


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(7-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13244.44 Da        Isoelectric Point: 8.0113

>T244584 WP_002362432.1 NZ_CP097047:c42346-42005 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT244584 WP_002362431.1 NZ_CP097047:c42576-42346 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z2CGM4

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References