Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 2693699..2694270 | Replicon | chromosome |
| Accession | NZ_CP097046 | ||
| Organism | Enterococcus faecalis strain AT29 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | M2907_RS12915 | Protein ID | WP_174114068.1 |
| Coordinates | 2693699..2694040 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R3JGB1 |
| Locus tag | M2907_RS12920 | Protein ID | WP_002354773.1 |
| Coordinates | 2694040..2694270 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2907_RS12910 (2689714) | 2689714..2693328 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
| M2907_RS12915 (2693699) | 2693699..2694040 | - | 342 | WP_174114068.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| M2907_RS12920 (2694040) | 2694040..2694270 | - | 231 | WP_002354773.1 | hypothetical protein | Antitoxin |
| M2907_RS12925 (2694685) | 2694685..2694900 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
| M2907_RS12930 (2695039) | 2695039..2696031 | + | 993 | WP_002378862.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| M2907_RS12935 (2696198) | 2696198..2696836 | - | 639 | WP_002378863.1 | lytic polysaccharide monooxygenase | - |
| M2907_RS12940 (2697522) | 2697522..2699138 | + | 1617 | WP_174114069.1 | phosphatase PAP2/LCP family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13177.42 Da Isoelectric Point: 8.8678
>T244574 WP_174114068.1 NZ_CP097046:c2694040-2693699 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPIISTIKNIPTRYTLPDDIETHGQVVISQ
LQSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPIISTIKNIPTRYTLPDDIETHGQVVISQ
LQSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|