244556

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 30712..31283 Replicon plasmid pAT34-a
Accession NZ_CP097043
Organism Enterococcus faecalis strain AT34

Toxin (Protein)


Gene name mazF Uniprot ID A0A2Z2CGM4
Locus tag M2910_RS13135 Protein ID WP_002362432.1
Coordinates 30712..31053 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag M2910_RS13140 Protein ID WP_002362431.1
Coordinates 31053..31283 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M2910_RS13115 (M2910_13115) 26111..27394 - 1284 Protein_29 hypothetical protein -
M2910_RS13125 (M2910_13125) 28795..29397 - 603 WP_002362434.1 Fic family protein -
M2910_RS13130 (M2910_13130) 29662..30600 - 939 WP_002362433.1 hypothetical protein -
M2910_RS13135 (M2910_13135) 30712..31053 - 342 WP_002362432.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
M2910_RS13140 (M2910_13140) 31053..31283 - 231 WP_002362431.1 hypothetical protein Antitoxin
M2910_RS13145 (M2910_13145) 31487..32107 + 621 WP_002367784.1 recombinase family protein -
M2910_RS13150 (M2910_13150) 32097..32411 + 315 WP_002367785.1 hypothetical protein -
M2910_RS13155 (M2910_13155) 32405..32611 + 207 WP_002367786.1 hypothetical protein -
M2910_RS13160 (M2910_13160) 32771..32965 + 195 WP_002367787.1 hypothetical protein -
M2910_RS13165 (M2910_13165) 32977..33168 + 192 WP_002367788.1 hypothetical protein -
M2910_RS13170 (M2910_13170) 33338..33553 + 216 WP_002367791.1 leucocin A/sakacin P family class II bacteriocin -
M2910_RS13175 (M2910_13175) 33554..33895 + 342 WP_002367792.1 bacteriocin immunity protein -
M2910_RS13180 (M2910_13180) 34311..34829 + 519 WP_002367793.1 hypothetical protein -
M2910_RS13185 (M2910_13185) 34777..34992 + 216 WP_002415356.1 hypothetical protein -
M2910_RS13190 (M2910_13190) 35084..35170 + 87 WP_012881081.1 type I toxin-antitoxin system Fst family toxin -
M2910_RS13195 (M2910_13195) 35427..35723 + 297 WP_002367795.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid cat / tet(L) / tet(M) / fexA / optrA / erm(B) - 1..40376 40376


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(7-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13244.44 Da        Isoelectric Point: 8.0113

>T244556 WP_002362432.1 NZ_CP097043:c31053-30712 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT244556 WP_002362431.1 NZ_CP097043:c31283-31053 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z2CGM4

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References