Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 76499..77636 | Replicon | plasmid pAT39-a |
Accession | NZ_CP097039 | ||
Organism | Enterococcus faecalis strain AT39 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | P0A4M2 |
Locus tag | M2911_RS13785 | Protein ID | WP_002332783.1 |
Coordinates | 76499..77362 (-) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | Q9AL19 |
Locus tag | M2911_RS13790 | Protein ID | WP_002326825.1 |
Coordinates | 77364..77636 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2911_RS13750 (M2911_13750) | 71624..72532 | - | 909 | WP_001255866.1 | aminoglycoside nucleotidyltransferase ANT(6)-Ia | - |
M2911_RS13755 (M2911_13755) | 72551..72667 | - | 117 | Protein_79 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
M2911_RS13760 (M2911_13760) | 72837..73574 | - | 738 | WP_002292226.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
M2911_RS13765 (M2911_13765) | 73699..73782 | - | 84 | WP_032501549.1 | 23S rRNA methyltransferase attenuator leader peptide ErmL | - |
M2911_RS14095 | 73831..73914 | - | 84 | Protein_82 | MLS leader peptide | - |
M2911_RS13770 (M2911_13770) | 74225..74905 | + | 681 | WP_010713944.1 | IS6-like element IS1216 family transposase | - |
M2911_RS13775 (M2911_13775) | 74939..75445 | - | 507 | WP_002415429.1 | trimethoprim-resistant dihydrofolate reductase DfrG | - |
M2911_RS13780 (M2911_13780) | 75742..76059 | - | 318 | WP_002326830.1 | hypothetical protein | - |
M2911_RS13785 (M2911_13785) | 76499..77362 | - | 864 | WP_002332783.1 | zeta toxin family protein | Toxin |
M2911_RS13790 (M2911_13790) | 77364..77636 | - | 273 | WP_002326825.1 | antitoxin | Antitoxin |
M2911_RS13795 (M2911_13795) | 77654..77869 | - | 216 | WP_001835296.1 | peptide-binding protein | - |
M2911_RS13800 (M2911_13800) | 77961..78857 | - | 897 | WP_248882076.1 | ParA family protein | - |
M2911_RS13805 (M2911_13805) | 78960..79220 | - | 261 | Protein_90 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
M2911_RS13810 (M2911_13810) | 79390..80127 | - | 738 | WP_001038796.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
M2911_RS13815 (M2911_13815) | 80252..80335 | - | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
M2911_RS14100 | 80384..80467 | - | 84 | Protein_93 | MLS leader peptide | - |
M2911_RS13820 (M2911_13820) | 80767..81138 | - | 372 | WP_002358205.1 | hypothetical protein | - |
M2911_RS13825 (M2911_13825) | 81131..81976 | - | 846 | WP_000239313.1 | AAA family ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | cat / tet(L) / tet(M) / erm(B) / aph(3')-III / ant(6)-Ia / dfrG | - | 1..82447 | 82447 | |
- | inside | IS/Tn | erm(B) / aph(3')-III / ant(6)-Ia / dfrG | - | 68711..80127 | 11416 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32675.27 Da Isoelectric Point: 7.3939
>T244540 WP_002332783.1 NZ_CP097039:c77362-76499 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | P0A4M2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2AF93 |