Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) omega-epsilon-zeta/zeta-epsilon
Location 76499..77636 Replicon plasmid pAT39-a
Accession NZ_CP097039
Organism Enterococcus faecalis strain AT39

Toxin (Protein)


Gene name zeta Uniprot ID P0A4M2
Locus tag M2911_RS13785 Protein ID WP_002332783.1
Coordinates 76499..77362 (-) Length 288 a.a.

Antitoxin (Protein)


Gene name epsilon Uniprot ID Q9AL19
Locus tag M2911_RS13790 Protein ID WP_002326825.1
Coordinates 77364..77636 (-) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M2911_RS13750 (M2911_13750) 71624..72532 - 909 WP_001255866.1 aminoglycoside nucleotidyltransferase ANT(6)-Ia -
M2911_RS13755 (M2911_13755) 72551..72667 - 117 Protein_79 topoisomerase DNA-binding C4 zinc finger domain-containing protein -
M2911_RS13760 (M2911_13760) 72837..73574 - 738 WP_002292226.1 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) -
M2911_RS13765 (M2911_13765) 73699..73782 - 84 WP_032501549.1 23S rRNA methyltransferase attenuator leader peptide ErmL -
M2911_RS14095 73831..73914 - 84 Protein_82 MLS leader peptide -
M2911_RS13770 (M2911_13770) 74225..74905 + 681 WP_010713944.1 IS6-like element IS1216 family transposase -
M2911_RS13775 (M2911_13775) 74939..75445 - 507 WP_002415429.1 trimethoprim-resistant dihydrofolate reductase DfrG -
M2911_RS13780 (M2911_13780) 75742..76059 - 318 WP_002326830.1 hypothetical protein -
M2911_RS13785 (M2911_13785) 76499..77362 - 864 WP_002332783.1 zeta toxin family protein Toxin
M2911_RS13790 (M2911_13790) 77364..77636 - 273 WP_002326825.1 antitoxin Antitoxin
M2911_RS13795 (M2911_13795) 77654..77869 - 216 WP_001835296.1 peptide-binding protein -
M2911_RS13800 (M2911_13800) 77961..78857 - 897 WP_248882076.1 ParA family protein -
M2911_RS13805 (M2911_13805) 78960..79220 - 261 Protein_90 topoisomerase DNA-binding C4 zinc finger domain-containing protein -
M2911_RS13810 (M2911_13810) 79390..80127 - 738 WP_001038796.1 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) -
M2911_RS13815 (M2911_13815) 80252..80335 - 84 WP_001814874.1 23S rRNA methyltransferase attenuation leader peptide -
M2911_RS14100 80384..80467 - 84 Protein_93 MLS leader peptide -
M2911_RS13820 (M2911_13820) 80767..81138 - 372 WP_002358205.1 hypothetical protein -
M2911_RS13825 (M2911_13825) 81131..81976 - 846 WP_000239313.1 AAA family ATPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid cat / tet(L) / tet(M) / erm(B) / aph(3')-III / ant(6)-Ia / dfrG - 1..82447 82447
- inside IS/Tn erm(B) / aph(3')-III / ant(6)-Ia / dfrG - 68711..80127 11416


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Zeta toxin domain

(28-214)

Antitoxin

Bacterial epsilon antitoxin

(2-90)


Sequences

Toxin        


Download         Length: 288 a.a.        Molecular weight: 32675.27 Da        Isoelectric Point: 7.3939

>T244540 WP_002332783.1 NZ_CP097039:c77362-76499 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI

Download         Length: 864 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 10720.17 Da        Isoelectric Point: 4.4865

>AT244540 WP_002326825.1 NZ_CP097039:c77636-77364 [Enterococcus faecalis]
MAVTYEKTFEIEIINELSASVYNRVLNYVLNHELDTKNTRLLEVNLLNQLEVAQEVDLFQQPFEELQAIHEYWRSMNQYS
KQILTKEKVA

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB P0A4M2

Antitoxin

Source ID Structure
AlphaFold DB A0A0M2AF93

References