244539

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 62104..62675 Replicon plasmid pAT39-a
Accession NZ_CP097039
Organism Enterococcus faecalis strain AT39

Toxin (Protein)


Gene name mazF Uniprot ID S4H3R9
Locus tag M2911_RS13660 Protein ID WP_010784114.1
Coordinates 62104..62445 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag M2911_RS13665 Protein ID WP_002362431.1
Coordinates 62445..62675 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M2911_RS13640 (M2911_13640) 57503..58786 - 1284 WP_002405123.1 hypothetical protein -
M2911_RS13650 (M2911_13650) 60187..60789 - 603 WP_002362434.1 Fic family protein -
M2911_RS13655 (M2911_13655) 61054..61992 - 939 WP_002362433.1 hypothetical protein -
M2911_RS13660 (M2911_13660) 62104..62445 - 342 WP_010784114.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
M2911_RS13665 (M2911_13665) 62445..62675 - 231 WP_002362431.1 hypothetical protein Antitoxin
M2911_RS13670 (M2911_13670) 62879..63499 + 621 WP_002367784.1 recombinase family protein -
M2911_RS13675 (M2911_13675) 63489..63803 + 315 WP_002367785.1 hypothetical protein -
M2911_RS13680 (M2911_13680) 63797..64003 + 207 WP_002367786.1 hypothetical protein -
M2911_RS13685 (M2911_13685) 64163..64357 + 195 WP_002367787.1 hypothetical protein -
M2911_RS13690 (M2911_13690) 64369..64560 + 192 WP_002367788.1 hypothetical protein -
M2911_RS13695 (M2911_13695) 64730..64945 + 216 WP_002367791.1 leucocin A/sakacin P family class II bacteriocin -
M2911_RS13700 (M2911_13700) 64946..65287 + 342 WP_002367792.1 bacteriocin immunity protein -
M2911_RS13705 (M2911_13705) 65703..66221 + 519 WP_002367793.1 hypothetical protein -
M2911_RS13710 (M2911_13710) 66169..66384 + 216 WP_002415356.1 hypothetical protein -
M2911_RS13715 (M2911_13715) 66476..66562 + 87 WP_012881081.1 type I toxin-antitoxin system Fst family toxin -
M2911_RS13720 (M2911_13720) 66819..67115 + 297 WP_002367795.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid cat / tet(L) / tet(M) / erm(B) / aph(3')-III / ant(6)-Ia / dfrG - 1..82447 82447


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(7-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13270.47 Da        Isoelectric Point: 7.9750

>T244539 WP_010784114.1 NZ_CP097039:c62445-62104 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEYLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT244539 WP_002362431.1 NZ_CP097039:c62675-62445 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S4H3R9

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References