244527

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ImmA-IrrE/HTH_19(antitoxin)
Location 1801369..1802063 Replicon chromosome
Accession NZ_CP097038
Organism Enterococcus faecalis strain AT39

Toxin (Protein)


Gene name IrrE Uniprot ID -
Locus tag M2911_RS08710 Protein ID WP_105194759.1
Coordinates 1801719..1802063 (+) Length 115 a.a.

Antitoxin (Protein)


Gene name ImmA Uniprot ID -
Locus tag M2911_RS08705 Protein ID WP_002364355.1
Coordinates 1801369..1801701 (+) Length 111 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M2911_RS08650 (1796480) 1796480..1796680 - 201 WP_057086713.1 hypothetical protein -
M2911_RS08655 (1796677) 1796677..1796895 - 219 WP_104870337.1 hypothetical protein -
M2911_RS08660 (1796897) 1796897..1797808 - 912 WP_105194763.1 YqaJ viral recombinase family protein -
M2911_RS08665 (1797821) 1797821..1798063 - 243 WP_010826713.1 hypothetical protein -
M2911_RS08670 (1798065) 1798065..1799261 - 1197 WP_016626781.1 DEAD/DEAH box helicase -
M2911_RS08675 (1799251) 1799251..1799544 - 294 WP_010826715.1 VRR-NUC domain-containing protein -
M2911_RS08680 (1799541) 1799541..1799741 - 201 WP_105194762.1 hypothetical protein -
M2911_RS08685 (1799956) 1799956..1800255 - 300 WP_248881988.1 hypothetical protein -
M2911_RS08690 (1800373) 1800373..1800552 - 180 WP_002395800.1 hypothetical protein -
M2911_RS08695 (1800559) 1800559..1800870 - 312 WP_105194760.1 hypothetical protein -
M2911_RS08700 (1800881) 1800881..1801057 - 177 WP_002364354.1 helix-turn-helix transcriptional regulator -
M2911_RS08705 (1801369) 1801369..1801701 + 333 WP_002364355.1 helix-turn-helix transcriptional regulator Antitoxin
M2911_RS08710 (1801719) 1801719..1802063 + 345 WP_105194759.1 ImmA/IrrE family metallo-endopeptidase Toxin
M2911_RS08715 (1802097) 1802097..1802825 + 729 WP_033918699.1 potassium channel family protein -
M2911_RS08720 (1802922) 1802922..1804070 + 1149 WP_105194837.1 site-specific integrase -
M2911_RS08725 (1804098) 1804098..1804541 - 444 WP_248881990.1 competence type IV pilus minor pilin ComGD -
M2911_RS08730 (1804538) 1804538..1804813 - 276 WP_002356991.1 competence type IV pilus major pilin ComGC -
M2911_RS08735 (1804813) 1804813..1805859 - 1047 WP_033786346.1 competence type IV pilus assembly protein ComGB -
M2911_RS08740 (1805816) 1805816..1806784 - 969 WP_002364362.1 competence type IV pilus ATPase ComGA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1768107..1804514 36407


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

IrrE N-terminal-like domain

(22-81)

Antitoxin

Cro/C1-type helix-turn-helix domain

(5-63)


Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 13707.58 Da        Isoelectric Point: 5.5339

>T244527 WP_105194759.1 NZ_CP097038:1801719-1802063 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPSERIIFVNQNLSIEEQEESIFHEFKHVVSHSDYMELYKIPSFRNKMEAEADH
HMFKCLIEKHEGQFNYSNVVTHYNLKMGQETYLK

Download         Length: 345 bp

Antitoxin


Download         Length: 111 a.a.        Molecular weight: 12691.16 Da        Isoelectric Point: 4.6307

>AT244527 WP_002364355.1 NZ_CP097038:1801369-1801701 [Enterococcus faecalis]
MNLLERIKKLAKDRDVSIYQLEEEINIGRNTIYQWNKRTPSSDKLEAVANYFNVSVDYLLGRTENPNQAGAKPSDDLDEV
LDNVMSFDGEPLDDHDREVIRAYLKGRFGK

Download         Length: 333 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References