Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ImmA-IrrE/HTH_19(antitoxin) |
| Location | 1801369..1802063 | Replicon | chromosome |
| Accession | NZ_CP097038 | ||
| Organism | Enterococcus faecalis strain AT39 | ||
Toxin (Protein)
| Gene name | IrrE | Uniprot ID | - |
| Locus tag | M2911_RS08710 | Protein ID | WP_105194759.1 |
| Coordinates | 1801719..1802063 (+) | Length | 115 a.a. |
Antitoxin (Protein)
| Gene name | ImmA | Uniprot ID | - |
| Locus tag | M2911_RS08705 | Protein ID | WP_002364355.1 |
| Coordinates | 1801369..1801701 (+) | Length | 111 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2911_RS08650 (1796480) | 1796480..1796680 | - | 201 | WP_057086713.1 | hypothetical protein | - |
| M2911_RS08655 (1796677) | 1796677..1796895 | - | 219 | WP_104870337.1 | hypothetical protein | - |
| M2911_RS08660 (1796897) | 1796897..1797808 | - | 912 | WP_105194763.1 | YqaJ viral recombinase family protein | - |
| M2911_RS08665 (1797821) | 1797821..1798063 | - | 243 | WP_010826713.1 | hypothetical protein | - |
| M2911_RS08670 (1798065) | 1798065..1799261 | - | 1197 | WP_016626781.1 | DEAD/DEAH box helicase | - |
| M2911_RS08675 (1799251) | 1799251..1799544 | - | 294 | WP_010826715.1 | VRR-NUC domain-containing protein | - |
| M2911_RS08680 (1799541) | 1799541..1799741 | - | 201 | WP_105194762.1 | hypothetical protein | - |
| M2911_RS08685 (1799956) | 1799956..1800255 | - | 300 | WP_248881988.1 | hypothetical protein | - |
| M2911_RS08690 (1800373) | 1800373..1800552 | - | 180 | WP_002395800.1 | hypothetical protein | - |
| M2911_RS08695 (1800559) | 1800559..1800870 | - | 312 | WP_105194760.1 | hypothetical protein | - |
| M2911_RS08700 (1800881) | 1800881..1801057 | - | 177 | WP_002364354.1 | helix-turn-helix transcriptional regulator | - |
| M2911_RS08705 (1801369) | 1801369..1801701 | + | 333 | WP_002364355.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| M2911_RS08710 (1801719) | 1801719..1802063 | + | 345 | WP_105194759.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
| M2911_RS08715 (1802097) | 1802097..1802825 | + | 729 | WP_033918699.1 | potassium channel family protein | - |
| M2911_RS08720 (1802922) | 1802922..1804070 | + | 1149 | WP_105194837.1 | site-specific integrase | - |
| M2911_RS08725 (1804098) | 1804098..1804541 | - | 444 | WP_248881990.1 | competence type IV pilus minor pilin ComGD | - |
| M2911_RS08730 (1804538) | 1804538..1804813 | - | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | - |
| M2911_RS08735 (1804813) | 1804813..1805859 | - | 1047 | WP_033786346.1 | competence type IV pilus assembly protein ComGB | - |
| M2911_RS08740 (1805816) | 1805816..1806784 | - | 969 | WP_002364362.1 | competence type IV pilus ATPase ComGA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1768107..1804514 | 36407 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13707.58 Da Isoelectric Point: 5.5339
>T244527 WP_105194759.1 NZ_CP097038:1801719-1802063 [Enterococcus faecalis]
MKSIKELVEEYEVELVFAPINKRACYEPSERIIFVNQNLSIEEQEESIFHEFKHVVSHSDYMELYKIPSFRNKMEAEADH
HMFKCLIEKHEGQFNYSNVVTHYNLKMGQETYLK
MKSIKELVEEYEVELVFAPINKRACYEPSERIIFVNQNLSIEEQEESIFHEFKHVVSHSDYMELYKIPSFRNKMEAEADH
HMFKCLIEKHEGQFNYSNVVTHYNLKMGQETYLK
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|