Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 24627..25198 | Replicon | plasmid pAT40b-c |
| Accession | NZ_CP097037 | ||
| Organism | Enterococcus faecalis strain AT40b | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A2P6BPI5 |
| Locus tag | M2913_RS14410 | Protein ID | WP_002394791.1 |
| Coordinates | 24627..24968 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R3KHK9 |
| Locus tag | M2913_RS14415 | Protein ID | WP_002362431.1 |
| Coordinates | 24968..25198 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2913_RS14380 (M2913_14380) | 20299..20385 | + | 87 | Protein_23 | DUF4180 domain-containing protein | - |
| M2913_RS14385 (M2913_14385) | 20772..21482 | - | 711 | Protein_24 | ISNCY family transposase | - |
| M2913_RS14390 (M2913_14390) | 21543..22223 | - | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
| M2913_RS14395 (M2913_14395) | 22300..22473 | + | 174 | Protein_26 | IS6 family transposase | - |
| M2913_RS14400 (M2913_14400) | 22707..23309 | - | 603 | WP_002367780.1 | Fic family protein | - |
| M2913_RS14405 (M2913_14405) | 23577..24515 | - | 939 | WP_002394789.1 | hypothetical protein | - |
| M2913_RS14410 (M2913_14410) | 24627..24968 | - | 342 | WP_002394791.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| M2913_RS14415 (M2913_14415) | 24968..25198 | - | 231 | WP_002362431.1 | hypothetical protein | Antitoxin |
| M2913_RS14420 (M2913_14420) | 25402..26022 | + | 621 | WP_002367784.1 | recombinase family protein | - |
| M2913_RS14425 (M2913_14425) | 26012..26326 | + | 315 | WP_002367785.1 | hypothetical protein | - |
| M2913_RS14430 (M2913_14430) | 26320..26526 | + | 207 | WP_002367786.1 | hypothetical protein | - |
| M2913_RS14435 (M2913_14435) | 26686..26880 | + | 195 | WP_002367787.1 | hypothetical protein | - |
| M2913_RS14440 (M2913_14440) | 26892..27083 | + | 192 | WP_002367788.1 | hypothetical protein | - |
| M2913_RS14445 (M2913_14445) | 27253..27468 | + | 216 | WP_002367791.1 | leucocin A/sakacin P family class II bacteriocin | - |
| M2913_RS14450 (M2913_14450) | 27469..27810 | + | 342 | WP_002367792.1 | bacteriocin immunity protein | - |
| M2913_RS14455 (M2913_14455) | 28226..28744 | + | 519 | WP_002367793.1 | hypothetical protein | - |
| M2913_RS14460 (M2913_14460) | 28692..28907 | + | 216 | WP_002415356.1 | hypothetical protein | - |
| M2913_RS14465 (M2913_14465) | 28999..29085 | + | 87 | WP_012881081.1 | type I toxin-antitoxin system Fst family toxin | - |
| M2913_RS14470 (M2913_14470) | 29342..29638 | + | 297 | WP_002367795.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | Cfr(D) | - | 1..32754 | 32754 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13248.49 Da Isoelectric Point: 8.8595
>T244523 WP_002394791.1 NZ_CP097037:c24968-24627 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MSDEKKYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P6BPI5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R3KHK9 |