Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 24627..25198 Replicon plasmid pAT40b-c
Accession NZ_CP097037
Organism Enterococcus faecalis strain AT40b

Toxin (Protein)


Gene name mazF Uniprot ID A0A2P6BPI5
Locus tag M2913_RS14410 Protein ID WP_002394791.1
Coordinates 24627..24968 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag M2913_RS14415 Protein ID WP_002362431.1
Coordinates 24968..25198 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M2913_RS14380 (M2913_14380) 20299..20385 + 87 Protein_23 DUF4180 domain-containing protein -
M2913_RS14385 (M2913_14385) 20772..21482 - 711 Protein_24 ISNCY family transposase -
M2913_RS14390 (M2913_14390) 21543..22223 - 681 WP_001015311.1 IS6-like element IS1216 family transposase -
M2913_RS14395 (M2913_14395) 22300..22473 + 174 Protein_26 IS6 family transposase -
M2913_RS14400 (M2913_14400) 22707..23309 - 603 WP_002367780.1 Fic family protein -
M2913_RS14405 (M2913_14405) 23577..24515 - 939 WP_002394789.1 hypothetical protein -
M2913_RS14410 (M2913_14410) 24627..24968 - 342 WP_002394791.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
M2913_RS14415 (M2913_14415) 24968..25198 - 231 WP_002362431.1 hypothetical protein Antitoxin
M2913_RS14420 (M2913_14420) 25402..26022 + 621 WP_002367784.1 recombinase family protein -
M2913_RS14425 (M2913_14425) 26012..26326 + 315 WP_002367785.1 hypothetical protein -
M2913_RS14430 (M2913_14430) 26320..26526 + 207 WP_002367786.1 hypothetical protein -
M2913_RS14435 (M2913_14435) 26686..26880 + 195 WP_002367787.1 hypothetical protein -
M2913_RS14440 (M2913_14440) 26892..27083 + 192 WP_002367788.1 hypothetical protein -
M2913_RS14445 (M2913_14445) 27253..27468 + 216 WP_002367791.1 leucocin A/sakacin P family class II bacteriocin -
M2913_RS14450 (M2913_14450) 27469..27810 + 342 WP_002367792.1 bacteriocin immunity protein -
M2913_RS14455 (M2913_14455) 28226..28744 + 519 WP_002367793.1 hypothetical protein -
M2913_RS14460 (M2913_14460) 28692..28907 + 216 WP_002415356.1 hypothetical protein -
M2913_RS14465 (M2913_14465) 28999..29085 + 87 WP_012881081.1 type I toxin-antitoxin system Fst family toxin -
M2913_RS14470 (M2913_14470) 29342..29638 + 297 WP_002367795.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid Cfr(D) - 1..32754 32754


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(10-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13248.49 Da        Isoelectric Point: 8.8595

>T244523 WP_002394791.1 NZ_CP097037:c24968-24627 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT244523 WP_002362431.1 NZ_CP097037:c25198-24968 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P6BPI5

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References