Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 34735..35872 | Replicon | plasmid pAT40b-a |
Accession | NZ_CP097035 | ||
Organism | Enterococcus faecalis strain AT40b |
Toxin (Protein)
Gene name | zeta | Uniprot ID | - |
Locus tag | M2913_RS13650 | Protein ID | WP_248878840.1 |
Coordinates | 34735..35598 (-) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | Q9AL01 |
Locus tag | M2913_RS13655 | Protein ID | WP_002331065.1 |
Coordinates | 35600..35872 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2913_RS13620 (M2913_13620) | 29750..31744 | - | 1995 | WP_248878838.1 | MobA/MobL family protein | - |
M2913_RS13625 (M2913_13625) | 32027..32326 | + | 300 | WP_002332653.1 | hypothetical protein | - |
M2913_RS13630 (M2913_13630) | 32329..32586 | + | 258 | WP_000002668.1 | hypothetical protein | - |
M2913_RS13635 (M2913_13635) | 32680..32913 | - | 234 | WP_002332654.1 | hypothetical protein | - |
M2913_RS13640 (M2913_13640) | 32947..33444 | - | 498 | WP_002338758.1 | hypothetical protein | - |
M2913_RS13645 (M2913_13645) | 33978..34295 | - | 318 | WP_002326830.1 | hypothetical protein | - |
M2913_RS13650 (M2913_13650) | 34735..35598 | - | 864 | WP_248878840.1 | zeta toxin family protein | Toxin |
M2913_RS13655 (M2913_13655) | 35600..35872 | - | 273 | WP_002331065.1 | antitoxin | Antitoxin |
M2913_RS13660 (M2913_13660) | 35889..36098 | - | 210 | WP_000527318.1 | peptide-binding protein | - |
M2913_RS13665 (M2913_13665) | 36197..37093 | - | 897 | WP_002334978.1 | AAA family ATPase | - |
M2913_RS13670 (M2913_13670) | 37196..39340 | - | 2145 | WP_248878842.1 | type IA DNA topoisomerase | - |
M2913_RS13675 (M2913_13675) | 39340..39957 | - | 618 | WP_001062587.1 | recombinase family protein | - |
M2913_RS13680 (M2913_13680) | 39971..40141 | - | 171 | WP_000713595.1 | hypothetical protein | - |
M2913_RS13685 (M2913_13685) | 40497..40713 | - | 217 | Protein_42 | PadR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..92441 | 92441 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32598.15 Da Isoelectric Point: 6.9969
>T244522 WP_248878840.1 NZ_CP097035:c35598-34735 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEALISRLSDQGYNLVIEGTGRTTDVPIQTATMLQSKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELV
KLYEKDVVKHVTPYSNRMTEALISRLSDQGYNLVIEGTGRTTDVPIQTATMLQSKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|