Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 1369128..1370265 | Replicon | chromosome |
Accession | NZ_CP097034 | ||
Organism | Enterococcus faecalis strain AT40b |
Toxin (Protein)
Gene name | zeta | Uniprot ID | - |
Locus tag | M2913_RS06615 | Protein ID | WP_002401483.1 |
Coordinates | 1369128..1369991 (-) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | R2XCR7 |
Locus tag | M2913_RS06620 | Protein ID | WP_000301765.1 |
Coordinates | 1369993..1370265 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2913_RS06585 (1364599) | 1364599..1365462 | - | 864 | WP_002382350.1 | DNA-processing protein DprA | - |
M2913_RS06590 (1365523) | 1365523..1366290 | - | 768 | WP_002357481.1 | ribonuclease HII | - |
M2913_RS06595 (1366292) | 1366292..1367143 | - | 852 | WP_002357480.1 | ribosome biogenesis GTPase YlqF | - |
M2913_RS06600 (1367419) | 1367419..1367592 | - | 174 | Protein_1269 | ketopantoate reductase C-terminal domain-containing protein | - |
M2913_RS06605 (1367649) | 1367649..1368329 | - | 681 | WP_010710189.1 | IS6-like element IS1216 family transposase | - |
M2913_RS06610 (1368403) | 1368403..1368690 | - | 288 | Protein_1271 | DnaJ domain-containing protein | - |
M2913_RS06615 (1369128) | 1369128..1369991 | - | 864 | WP_002401483.1 | zeta toxin family protein | Toxin |
M2913_RS06620 (1369993) | 1369993..1370265 | - | 273 | WP_000301765.1 | antitoxin | Antitoxin |
M2913_RS06625 (1370282) | 1370282..1370497 | - | 216 | WP_002295735.1 | peptide-binding protein | - |
M2913_RS06630 (1370596) | 1370596..1371492 | - | 897 | WP_002387620.1 | ParA family protein | - |
M2913_RS06635 (1371595) | 1371595..1371855 | - | 261 | Protein_1276 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
M2913_RS06640 (1372025) | 1372025..1372762 | - | 738 | WP_002292226.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
M2913_RS06645 (1372887) | 1372887..1372982 | - | 96 | WP_001809736.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
M2913_RS06650 (1373051) | 1373051..1373173 | - | 123 | Protein_1279 | peptide-binding protein | - |
M2913_RS06655 (1373293) | 1373293..1374819 | - | 1527 | WP_025191980.1 | type IA DNA topoisomerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | IScluster/Tn | erm(B) / ant(6)-Ia / lnu(B) / lsa(E) / aph(3')-III / aac(6')-aph(2'') | - | 1367649..1398012 | 30363 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32486.06 Da Isoelectric Point: 6.9965
>T244512 WP_002401483.1 NZ_CP097034:c1369991-1369128 [Enterococcus faecalis]
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAILEETQGNVIVIDNDTFKQQHPNFDELA
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSRLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMLQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGL
MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAILEETQGNVIVIDNDTFKQQHPNFDELA
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSRLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMLQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGL
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 3Q8X | |
PDB | 1GVN | |
AlphaFold DB | A0A829F0A3 |