244507

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 67194..67765 Replicon plasmid pAT41-a
Accession NZ_CP097032
Organism Enterococcus faecalis strain AT41

Toxin (Protein)


Gene name mazF Uniprot ID A0A2P6BPI5
Locus tag M2914_RS13560 Protein ID WP_002394791.1
Coordinates 67194..67535 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag M2914_RS13565 Protein ID WP_002362431.1
Coordinates 67535..67765 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M2914_RS13540 (M2914_13540) 63638..64120 + 483 WP_010817773.1 PTS glucose transporter subunit IIA -
M2914_RS13545 (M2914_13545) 64360..65040 + 681 WP_071621256.1 IS6 family transposase -
M2914_RS13550 (M2914_13550) 65274..65876 - 603 WP_002367780.1 Fic family protein -
M2914_RS13555 (M2914_13555) 66144..67082 - 939 WP_002394789.1 hypothetical protein -
M2914_RS13560 (M2914_13560) 67194..67535 - 342 WP_002394791.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
M2914_RS13565 (M2914_13565) 67535..67765 - 231 WP_002362431.1 hypothetical protein Antitoxin
M2914_RS13570 (M2914_13570) 67969..68589 + 621 WP_002375379.1 recombinase family protein -
M2914_RS13575 (M2914_13575) 68606..68893 + 288 WP_085406799.1 hypothetical protein -
M2914_RS13580 (M2914_13580) 68887..69132 + 246 WP_116495280.1 ultraviolet resistance protein UvrA repressor UvrC -
M2914_RS13585 (M2914_13585) 69172..69381 + 210 WP_002363054.1 hypothetical protein -
M2914_RS13590 (M2914_13590) 69395..69553 + 159 Protein_83 recombinase family protein -
M2914_RS13595 (M2914_13595) 69722..69973 + 252 WP_010815874.1 hypothetical protein -
M2914_RS13600 (M2914_13600) 70028..70465 - 438 WP_116495281.1 hypothetical protein -
M2914_RS13605 (M2914_13605) 70557..70808 + 252 WP_010815876.1 hypothetical protein -
M2914_RS13610 (M2914_13610) 70924..72240 + 1317 WP_116495282.1 Y-family DNA polymerase -
M2914_RS13615 (M2914_13615) 72244..72759 + 516 WP_002394804.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid cat / tet(L) / tet(M) / erm(B) / aph(3')-III / dfrG / aac(6')-aph(2'') bsh 1..75254 75254
- flank IS/Tn - - 64582..65040 458


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(10-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13248.49 Da        Isoelectric Point: 8.8595

>T244507 WP_002394791.1 NZ_CP097032:c67535-67194 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT244507 WP_002362431.1 NZ_CP097032:c67765-67535 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P6BPI5

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References