Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 67194..67765 | Replicon | plasmid pAT41-a |
| Accession | NZ_CP097032 | ||
| Organism | Enterococcus faecalis strain AT41 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A2P6BPI5 |
| Locus tag | M2914_RS13560 | Protein ID | WP_002394791.1 |
| Coordinates | 67194..67535 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R3KHK9 |
| Locus tag | M2914_RS13565 | Protein ID | WP_002362431.1 |
| Coordinates | 67535..67765 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2914_RS13540 (M2914_13540) | 63638..64120 | + | 483 | WP_010817773.1 | PTS glucose transporter subunit IIA | - |
| M2914_RS13545 (M2914_13545) | 64360..65040 | + | 681 | WP_071621256.1 | IS6 family transposase | - |
| M2914_RS13550 (M2914_13550) | 65274..65876 | - | 603 | WP_002367780.1 | Fic family protein | - |
| M2914_RS13555 (M2914_13555) | 66144..67082 | - | 939 | WP_002394789.1 | hypothetical protein | - |
| M2914_RS13560 (M2914_13560) | 67194..67535 | - | 342 | WP_002394791.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| M2914_RS13565 (M2914_13565) | 67535..67765 | - | 231 | WP_002362431.1 | hypothetical protein | Antitoxin |
| M2914_RS13570 (M2914_13570) | 67969..68589 | + | 621 | WP_002375379.1 | recombinase family protein | - |
| M2914_RS13575 (M2914_13575) | 68606..68893 | + | 288 | WP_085406799.1 | hypothetical protein | - |
| M2914_RS13580 (M2914_13580) | 68887..69132 | + | 246 | WP_116495280.1 | ultraviolet resistance protein UvrA repressor UvrC | - |
| M2914_RS13585 (M2914_13585) | 69172..69381 | + | 210 | WP_002363054.1 | hypothetical protein | - |
| M2914_RS13590 (M2914_13590) | 69395..69553 | + | 159 | Protein_83 | recombinase family protein | - |
| M2914_RS13595 (M2914_13595) | 69722..69973 | + | 252 | WP_010815874.1 | hypothetical protein | - |
| M2914_RS13600 (M2914_13600) | 70028..70465 | - | 438 | WP_116495281.1 | hypothetical protein | - |
| M2914_RS13605 (M2914_13605) | 70557..70808 | + | 252 | WP_010815876.1 | hypothetical protein | - |
| M2914_RS13610 (M2914_13610) | 70924..72240 | + | 1317 | WP_116495282.1 | Y-family DNA polymerase | - |
| M2914_RS13615 (M2914_13615) | 72244..72759 | + | 516 | WP_002394804.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | cat / tet(L) / tet(M) / erm(B) / aph(3')-III / dfrG / aac(6')-aph(2'') | bsh | 1..75254 | 75254 | |
| - | flank | IS/Tn | - | - | 64582..65040 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13248.49 Da Isoelectric Point: 8.8595
>T244507 WP_002394791.1 NZ_CP097032:c67535-67194 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MSDEKKYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P6BPI5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R3KHK9 |