Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 22933..24070 | Replicon | plasmid pAT41-a |
Accession | NZ_CP097032 | ||
Organism | Enterococcus faecalis strain AT41 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | P0A4M2 |
Locus tag | M2914_RS13315 | Protein ID | WP_002332783.1 |
Coordinates | 23207..24070 (+) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | Q9AL19 |
Locus tag | M2914_RS13310 | Protein ID | WP_002326825.1 |
Coordinates | 22933..23205 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2914_RS13270 (M2914_13270) | 17949..18032 | + | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
M2914_RS13275 (M2914_13275) | 18157..18894 | + | 738 | WP_002292226.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
M2914_RS13280 (M2914_13280) | 18898..19692 | + | 795 | WP_001096887.1 | aminoglycoside O-phosphotransferase APH(3')-IIIa | - |
M2914_RS13980 | 20102..20185 | + | 84 | Protein_21 | MLS leader peptide | - |
M2914_RS13285 (M2914_13285) | 20234..20317 | + | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
M2914_RS13290 (M2914_13290) | 20442..21179 | + | 738 | WP_001038789.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
M2914_RS13295 (M2914_13295) | 21349..21609 | + | 261 | Protein_24 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
M2914_RS13300 (M2914_13300) | 21712..22608 | + | 897 | WP_002326827.1 | ParA family protein | - |
M2914_RS13305 (M2914_13305) | 22700..22915 | + | 216 | WP_001835296.1 | peptide-binding protein | - |
M2914_RS13310 (M2914_13310) | 22933..23205 | + | 273 | WP_002326825.1 | antitoxin | Antitoxin |
M2914_RS13315 (M2914_13315) | 23207..24070 | + | 864 | WP_002332783.1 | zeta toxin family protein | Toxin |
M2914_RS13320 (M2914_13320) | 24510..24827 | + | 318 | WP_002326830.1 | hypothetical protein | - |
M2914_RS13325 (M2914_13325) | 25039..25323 | + | 285 | WP_000922261.1 | hypothetical protein | - |
M2914_RS13330 (M2914_13330) | 25330..27282 | + | 1953 | WP_000163792.1 | hypothetical protein | - |
M2914_RS13335 (M2914_13335) | 27354..27851 | - | 498 | WP_000868795.1 | trimethoprim-resistant dihydrofolate reductase DfrG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | cat / tet(L) / tet(M) / erm(B) / aph(3')-III / dfrG / aac(6')-aph(2'') | bsh | 1..75254 | 75254 | |
- | flank | IS/Tn | erm(B) / aph(3')-III | - | 16688..21179 | 4491 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32675.27 Da Isoelectric Point: 7.3939
>T244506 WP_002332783.1 NZ_CP097032:23207-24070 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | P0A4M2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2AF93 |