Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 475030..475601 | Replicon | chromosome |
| Accession | NZ_CP097027 | ||
| Organism | Enterococcus faecium strain AT44 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | Q3Y2B8 |
| Locus tag | M2916_RS02285 | Protein ID | WP_002286801.1 |
| Coordinates | 475260..475601 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A828ZZN9 |
| Locus tag | M2916_RS02280 | Protein ID | WP_002323011.1 |
| Coordinates | 475030..475260 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2916_RS02255 (M2916_02255) | 470511..471839 | + | 1329 | WP_002327434.1 | FAD-containing oxidoreductase | - |
| M2916_RS02260 (M2916_02260) | 471861..472487 | + | 627 | WP_002286816.1 | cysteine hydrolase | - |
| M2916_RS02265 (M2916_02265) | 472670..473251 | + | 582 | WP_002327433.1 | TetR/AcrR family transcriptional regulator | - |
| M2916_RS02270 (M2916_02270) | 473616..474191 | + | 576 | WP_002352505.1 | SOS response-associated peptidase family protein | - |
| M2916_RS02275 (M2916_02275) | 474396..474734 | - | 339 | WP_002306002.1 | hypothetical protein | - |
| M2916_RS02280 (M2916_02280) | 475030..475260 | + | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
| M2916_RS02285 (M2916_02285) | 475260..475601 | + | 342 | WP_002286801.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| M2916_RS02290 (M2916_02290) | 476451..476636 | + | 186 | WP_002304207.1 | hypothetical protein | - |
| M2916_RS02295 (M2916_02295) | 476906..478068 | + | 1163 | WP_086956687.1 | IS3 family transposase | - |
| M2916_RS02300 (M2916_02300) | 478199..478441 | + | 243 | Protein_456 | LPXTG cell wall anchor domain-containing protein | - |
| M2916_RS02305 (M2916_02305) | 478514..479410 | + | 897 | Protein_457 | class C sortase | - |
| M2916_RS02310 (M2916_02310) | 479591..480265 | + | 675 | WP_038811248.1 | response regulator transcription factor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13302.68 Da Isoelectric Point: 9.9044
>T244454 WP_002286801.1 NZ_CP097027:475260-475601 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIITQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FD66 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A828ZZN9 |