Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) omega-epsilon-zeta/zeta-epsilon
Location 56412..57549 Replicon plasmid pAT46a-a
Accession NZ_CP097021
Organism Enterococcus faecalis strain AT46a

Toxin (Protein)


Gene name zeta Uniprot ID P0A4M2
Locus tag M2918_RS13425 Protein ID WP_002332783.1
Coordinates 56412..57275 (-) Length 288 a.a.

Antitoxin (Protein)


Gene name epsilon Uniprot ID Q9AL19
Locus tag M2918_RS13430 Protein ID WP_002326825.1
Coordinates 57277..57549 (-) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M2918_RS13390 (M2918_13390) 51525..52433 - 909 WP_001255866.1 aminoglycoside nucleotidyltransferase ANT(6)-Ia -
M2918_RS13395 (M2918_13395) 52452..52568 - 117 Protein_64 topoisomerase DNA-binding C4 zinc finger domain-containing protein -
M2918_RS13400 (M2918_13400) 52738..53475 - 738 WP_181710332.1 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) -
M2918_RS13405 (M2918_13405) 53600..53683 - 84 WP_001814874.1 23S rRNA methyltransferase attenuation leader peptide -
M2918_RS13520 53732..53815 - 84 Protein_67 MLS leader peptide -
M2918_RS13410 (M2918_13410) 54138..54818 + 681 WP_010710189.1 IS6-like element IS1216 family transposase -
M2918_RS13415 (M2918_13415) 54852..55358 - 507 WP_002415429.1 trimethoprim-resistant dihydrofolate reductase DfrG -
M2918_RS13420 (M2918_13420) 55655..55972 - 318 WP_002326830.1 hypothetical protein -
M2918_RS13425 (M2918_13425) 56412..57275 - 864 WP_002332783.1 zeta toxin family protein Toxin
M2918_RS13430 (M2918_13430) 57277..57549 - 273 WP_002326825.1 antitoxin Antitoxin
M2918_RS13435 (M2918_13435) 57567..57782 - 216 WP_001835296.1 peptide-binding protein -
M2918_RS13440 (M2918_13440) 57874..58770 - 897 WP_002326827.1 ParA family protein -
M2918_RS13445 (M2918_13445) 58873..59133 - 261 Protein_75 topoisomerase DNA-binding C4 zinc finger domain-containing protein -
M2918_RS13450 (M2918_13450) 59303..60040 - 738 WP_001038795.1 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) -
M2918_RS13455 (M2918_13455) 60165..60248 - 84 WP_001814874.1 23S rRNA methyltransferase attenuation leader peptide -
M2918_RS13525 60297..60380 - 84 Protein_78 MLS leader peptide -
M2918_RS13460 (M2918_13460) 60680..61051 - 372 WP_002358205.1 hypothetical protein -
M2918_RS13465 (M2918_13465) 61044..61889 - 846 WP_000239313.1 AAA family ATPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid cat / tet(L) / tet(M) / str / erm(B) / aph(3')-III / ant(6)-Ia / dfrG - 1..62360 62360
- inside IS/Tn erm(B) / aph(3')-III / ant(6)-Ia / dfrG - 48612..60040 11428


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Zeta toxin domain

(28-214)

Antitoxin

Bacterial epsilon antitoxin

(2-90)


Sequences

Toxin        


Download         Length: 288 a.a.        Molecular weight: 32675.27 Da        Isoelectric Point: 7.3939

>T244448 WP_002332783.1 NZ_CP097021:c57275-56412 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI

Download         Length: 864 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 10720.17 Da        Isoelectric Point: 4.4865

>AT244448 WP_002326825.1 NZ_CP097021:c57549-57277 [Enterococcus faecalis]
MAVTYEKTFEIEIINELSASVYNRVLNYVLNHELDTKNTRLLEVNLLNQLEVAQEVDLFQQPFEELQAIHEYWRSMNQYS
KQILTKEKVA

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB P0A4M2

Antitoxin

Source ID Structure
AlphaFold DB A0A0M2AF93

References