Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 2656564..2657135 | Replicon | chromosome |
Accession | NZ_CP097020 | ||
Organism | Enterococcus faecalis strain AT46a |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | M2918_RS12615 | Protein ID | WP_174114068.1 |
Coordinates | 2656564..2656905 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | R3JGB1 |
Locus tag | M2918_RS12620 | Protein ID | WP_002354773.1 |
Coordinates | 2656905..2657135 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2918_RS12610 (2652579) | 2652579..2656193 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
M2918_RS12615 (2656564) | 2656564..2656905 | - | 342 | WP_174114068.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
M2918_RS12620 (2656905) | 2656905..2657135 | - | 231 | WP_002354773.1 | hypothetical protein | Antitoxin |
M2918_RS12625 (2657550) | 2657550..2657765 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
M2918_RS12630 (2657904) | 2657904..2658896 | + | 993 | WP_002378862.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
M2918_RS12635 (2659063) | 2659063..2659701 | - | 639 | WP_002378863.1 | lytic polysaccharide monooxygenase | - |
M2918_RS12640 (2660387) | 2660387..2662003 | + | 1617 | WP_174114069.1 | phosphatase PAP2/LCP family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13177.42 Da Isoelectric Point: 8.8678
>T244437 WP_174114068.1 NZ_CP097020:c2656905-2656564 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPIISTIKNIPTRYTLPDDIETHGQVVISQ
LQSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPIISTIKNIPTRYTLPDDIETHGQVVISQ
LQSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|