Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Xre-MNT/HTH_26(antitoxin) |
Location | 59736..60844 | Replicon | plasmid pAT47b-a |
Accession | NZ_CP097015 | ||
Organism | Enterococcus faecium strain AT47b |
Toxin (Protein)
Gene name | MNTss | Uniprot ID | A0A3S8RBH6 |
Locus tag | M2920_RS13000 | Protein ID | WP_071661597.1 |
Coordinates | 59736..60605 (-) | Length | 290 a.a. |
Antitoxin (Protein)
Gene name | Xress | Uniprot ID | - |
Locus tag | M2920_RS13005 | Protein ID | WP_000205227.1 |
Coordinates | 60620..60844 (-) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2920_RS12965 (M2920_12965) | 55092..55325 | - | 234 | WP_002295764.1 | addiction module antitoxin | - |
M2920_RS12970 (M2920_12970) | 55647..56732 | + | 1086 | WP_002328898.1 | tyrosine recombinase XerS | - |
M2920_RS12975 (M2920_12975) | 56795..57349 | - | 555 | WP_002295761.1 | tyrosine-type recombinase/integrase | - |
M2920_RS12980 (M2920_12980) | 57709..58389 | - | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
M2920_RS12985 (M2920_12985) | 58467..58859 | - | 393 | WP_000393259.1 | GNAT family N-acetyltransferase | - |
M2920_RS12990 (M2920_12990) | 58878..58988 | - | 111 | Protein_71 | aminoglycoside 6-adenylyltransferase | - |
M2920_RS12995 (M2920_12995) | 59021..59755 | - | 735 | WP_000662263.1 | class I SAM-dependent methyltransferase | - |
M2920_RS13000 (M2920_13000) | 59736..60605 | - | 870 | WP_071661597.1 | nucleotidyltransferase domain-containing protein | Toxin |
M2920_RS13005 (M2920_13005) | 60620..60844 | - | 225 | WP_000205227.1 | helix-turn-helix transcriptional regulator | Antitoxin |
M2920_RS13010 (M2920_13010) | 61262..62563 | + | 1302 | Protein_75 | ISL3 family transposase | - |
M2920_RS13015 (M2920_13015) | 62872..63675 | - | 804 | WP_002294514.1 | lincosamide nucleotidyltransferase Lnu(B) | - |
M2920_RS13020 (M2920_13020) | 63729..65213 | - | 1485 | WP_002294513.1 | ABC-F type ribosomal protection protein Lsa(E) | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32902.55 Da Isoelectric Point: 4.9770
>T244419 WP_071661597.1 NZ_CP097015:c60605-59736 [Enterococcus faecium]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEHKPEKYTE
KVNHIFEVLGISLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIIKDTEQGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAEIY
PTALKKSLMNFFIFEAEFSLMFVKANAGVEDKYYIAGHVFRIISCLNQVLFACNNAYCINEKKAIKLLETFEHKPEKYTE
KVNHIFEVLGISLFECYDMTEKLYKEVNEIVSEINNFLNEESSDERKQI
Download Length: 870 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|