Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 500607..501178 | Replicon | chromosome |
Accession | NZ_CP097014 | ||
Organism | Enterococcus faecium strain AT47b |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A828ZXV4 |
Locus tag | M2920_RS02360 | Protein ID | WP_002302307.1 |
Coordinates | 500837..501178 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A828ZZN9 |
Locus tag | M2920_RS02355 | Protein ID | WP_002323011.1 |
Coordinates | 500607..500837 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M2920_RS02330 (M2920_02330) | 496096..497424 | + | 1329 | WP_010718318.1 | FAD-dependent oxidoreductase | - |
M2920_RS02335 (M2920_02335) | 497446..498072 | + | 627 | WP_002286816.1 | cysteine hydrolase | - |
M2920_RS02340 (M2920_02340) | 498255..498836 | + | 582 | WP_002331663.1 | TetR/AcrR family transcriptional regulator | - |
M2920_RS02345 (M2920_02345) | 499201..499776 | + | 576 | WP_010718317.1 | SOS response-associated peptidase family protein | - |
M2920_RS02350 (M2920_02350) | 499981..500319 | - | 339 | WP_002286804.1 | hypothetical protein | - |
M2920_RS02355 (M2920_02355) | 500607..500837 | + | 231 | WP_002323011.1 | hypothetical protein | Antitoxin |
M2920_RS02360 (M2920_02360) | 500837..501178 | + | 342 | WP_002302307.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
M2920_RS02365 (M2920_02365) | 502028..502213 | + | 186 | WP_002304207.1 | hypothetical protein | - |
M2920_RS02375 (M2920_02375) | 503732..503974 | + | 243 | Protein_473 | LPXTG cell wall anchor domain-containing protein | - |
M2920_RS02380 (M2920_02380) | 504048..504941 | + | 894 | WP_002326335.1 | class C sortase | - |
M2920_RS02385 (M2920_02385) | 505125..505799 | + | 675 | WP_002291233.1 | response regulator transcription factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | ClpL | - | 431873..608967 | 177094 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13288.65 Da Isoelectric Point: 9.9044
>T244418 WP_002302307.1 NZ_CP097014:500837-501178 [Enterococcus faecium]
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIISQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
VSEERIYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFSVICPITSTIKNLPTRYSLPEELDIKGQVIISQ
LKSLDFKERKLKKIENLPLQDMAKIDQIIQYMF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A828ZXV4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A828ZZN9 |