244416

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) omega-epsilon-zeta/zeta-epsilon
Location 97006..98143 Replicon plasmid pAT48-a
Accession NZ_CP097011
Organism Enterococcus faecalis strain AT48

Toxin (Protein)


Gene name zeta Uniprot ID P0A4M2
Locus tag M2921_RS13625 Protein ID WP_002332783.1
Coordinates 97006..97869 (-) Length 288 a.a.

Antitoxin (Protein)


Gene name epsilon Uniprot ID Q9AL19
Locus tag M2921_RS13630 Protein ID WP_002326825.1
Coordinates 97871..98143 (-) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M2921_RS13580 (M2921_13585) 92246..92356 - 111 Protein_104 aminoglycoside 6-adenylyltransferase -
M2921_RS13585 (M2921_13590) 92375..92491 - 117 Protein_105 topoisomerase DNA-binding C4 zinc finger domain-containing protein -
M2921_RS13590 (M2921_13595) 92661..93398 - 738 WP_001038795.1 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) -
M2921_RS13595 (M2921_13600) 93523..93606 - 84 WP_001814874.1 23S rRNA methyltransferase attenuation leader peptide -
M2921_RS13600 (M2921_13605) 93729..93896 - 168 Protein_108 peptide-binding protein -
M2921_RS13605 (M2921_13610) 94030..94656 - 627 Protein_109 DNA topoisomerase -
M2921_RS13610 (M2921_13615) 94732..95412 + 681 WP_010710189.1 IS6-like element IS1216 family transposase -
M2921_RS13615 (M2921_13620) 95446..95952 - 507 WP_002415429.1 trimethoprim-resistant dihydrofolate reductase DfrG -
M2921_RS13620 (M2921_13625) 96249..96566 - 318 WP_002326830.1 hypothetical protein -
M2921_RS13625 (M2921_13630) 97006..97869 - 864 WP_002332783.1 zeta toxin family protein Toxin
M2921_RS13630 (M2921_13635) 97871..98143 - 273 WP_002326825.1 antitoxin Antitoxin
M2921_RS13635 (M2921_13640) 98161..98376 - 216 WP_001835296.1 peptide-binding protein -
M2921_RS13640 (M2921_13645) 98468..99364 - 897 WP_002326827.1 ParA family protein -
M2921_RS13645 (M2921_13650) 99467..99727 - 261 Protein_117 topoisomerase DNA-binding C4 zinc finger domain-containing protein -
M2921_RS13650 (M2921_13655) 99897..100634 - 738 WP_001038795.1 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) -
M2921_RS13655 (M2921_13660) 100759..100842 - 84 WP_001814874.1 23S rRNA methyltransferase attenuation leader peptide -
M2921_RS14235 100891..100974 - 84 Protein_120 MLS leader peptide -
M2921_RS13660 (M2921_13665) 101274..101645 - 372 WP_002358205.1 hypothetical protein -
M2921_RS13665 (M2921_13670) 101638..102483 - 846 WP_000239313.1 AAA family ATPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid cat / tet(L) / tet(M) / erm(B) / aph(3')-III / ant(6)-Ia / lnu(B) / lsa(E) / aac(6')-aph(2'') / dfrG - 1..102954 102954
- inside IS/Tn erm(B) / aph(3')-III / ant(6)-Ia / lnu(B) / lsa(E) / aac(6')-aph(2'') / dfrG - 76223..100634 24411


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Zeta toxin domain

(28-214)

Antitoxin

Bacterial epsilon antitoxin

(2-90)


Sequences

Toxin        


Download         Length: 288 a.a.        Molecular weight: 32675.27 Da        Isoelectric Point: 7.3939

>T244416 WP_002332783.1 NZ_CP097011:c97869-97006 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI

Download         Length: 864 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 10720.17 Da        Isoelectric Point: 4.4865

>AT244416 WP_002326825.1 NZ_CP097011:c98143-97871 [Enterococcus faecalis]
MAVTYEKTFEIEIINELSASVYNRVLNYVLNHELDTKNTRLLEVNLLNQLEVAQEVDLFQQPFEELQAIHEYWRSMNQYS
KQILTKEKVA

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB P0A4M2

Antitoxin

Source ID Structure
AlphaFold DB A0A0M2AF93

References