Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
| Location | 97006..98143 | Replicon | plasmid pAT48-a |
| Accession | NZ_CP097011 | ||
| Organism | Enterococcus faecalis strain AT48 | ||
Toxin (Protein)
| Gene name | zeta | Uniprot ID | P0A4M2 |
| Locus tag | M2921_RS13625 | Protein ID | WP_002332783.1 |
| Coordinates | 97006..97869 (-) | Length | 288 a.a. |
Antitoxin (Protein)
| Gene name | epsilon | Uniprot ID | Q9AL19 |
| Locus tag | M2921_RS13630 | Protein ID | WP_002326825.1 |
| Coordinates | 97871..98143 (-) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2921_RS13580 (M2921_13585) | 92246..92356 | - | 111 | Protein_104 | aminoglycoside 6-adenylyltransferase | - |
| M2921_RS13585 (M2921_13590) | 92375..92491 | - | 117 | Protein_105 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
| M2921_RS13590 (M2921_13595) | 92661..93398 | - | 738 | WP_001038795.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
| M2921_RS13595 (M2921_13600) | 93523..93606 | - | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
| M2921_RS13600 (M2921_13605) | 93729..93896 | - | 168 | Protein_108 | peptide-binding protein | - |
| M2921_RS13605 (M2921_13610) | 94030..94656 | - | 627 | Protein_109 | DNA topoisomerase | - |
| M2921_RS13610 (M2921_13615) | 94732..95412 | + | 681 | WP_010710189.1 | IS6-like element IS1216 family transposase | - |
| M2921_RS13615 (M2921_13620) | 95446..95952 | - | 507 | WP_002415429.1 | trimethoprim-resistant dihydrofolate reductase DfrG | - |
| M2921_RS13620 (M2921_13625) | 96249..96566 | - | 318 | WP_002326830.1 | hypothetical protein | - |
| M2921_RS13625 (M2921_13630) | 97006..97869 | - | 864 | WP_002332783.1 | zeta toxin family protein | Toxin |
| M2921_RS13630 (M2921_13635) | 97871..98143 | - | 273 | WP_002326825.1 | antitoxin | Antitoxin |
| M2921_RS13635 (M2921_13640) | 98161..98376 | - | 216 | WP_001835296.1 | peptide-binding protein | - |
| M2921_RS13640 (M2921_13645) | 98468..99364 | - | 897 | WP_002326827.1 | ParA family protein | - |
| M2921_RS13645 (M2921_13650) | 99467..99727 | - | 261 | Protein_117 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
| M2921_RS13650 (M2921_13655) | 99897..100634 | - | 738 | WP_001038795.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
| M2921_RS13655 (M2921_13660) | 100759..100842 | - | 84 | WP_001814874.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
| M2921_RS14235 | 100891..100974 | - | 84 | Protein_120 | MLS leader peptide | - |
| M2921_RS13660 (M2921_13665) | 101274..101645 | - | 372 | WP_002358205.1 | hypothetical protein | - |
| M2921_RS13665 (M2921_13670) | 101638..102483 | - | 846 | WP_000239313.1 | AAA family ATPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | cat / tet(L) / tet(M) / erm(B) / aph(3')-III / ant(6)-Ia / lnu(B) / lsa(E) / aac(6')-aph(2'') / dfrG | - | 1..102954 | 102954 | |
| - | inside | IS/Tn | erm(B) / aph(3')-III / ant(6)-Ia / lnu(B) / lsa(E) / aac(6')-aph(2'') / dfrG | - | 76223..100634 | 24411 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32675.27 Da Isoelectric Point: 7.3939
>T244416 WP_002332783.1 NZ_CP097011:c97869-97006 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | P0A4M2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0M2AF93 |