Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 69616..70187 Replicon plasmid pAT48-a
Accession NZ_CP097011
Organism Enterococcus faecalis strain AT48

Toxin (Protein)


Gene name mazF Uniprot ID A0A2Z2CGM4
Locus tag M2921_RS13415 Protein ID WP_002362432.1
Coordinates 69616..69957 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag M2921_RS13420 Protein ID WP_002362431.1
Coordinates 69957..70187 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M2921_RS13390 (M2921_13395) 64630..65325 - 696 WP_002405176.1 Fic family protein -
M2921_RS13395 (M2921_13400) 65374..65973 - 600 WP_002405175.1 tyrosine-type recombinase/integrase -
M2921_RS13405 (M2921_13410) 67699..68301 - 603 WP_002362434.1 Fic family protein -
M2921_RS13410 (M2921_13415) 68566..69504 - 939 WP_002362433.1 hypothetical protein -
M2921_RS13415 (M2921_13420) 69616..69957 - 342 WP_002362432.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
M2921_RS13420 (M2921_13425) 69957..70187 - 231 WP_002362431.1 hypothetical protein Antitoxin
M2921_RS13425 (M2921_13430) 70391..71011 + 621 WP_002367784.1 recombinase family protein -
M2921_RS13430 (M2921_13435) 71001..71315 + 315 WP_002367785.1 hypothetical protein -
M2921_RS13435 (M2921_13440) 71309..71515 + 207 WP_002367786.1 hypothetical protein -
M2921_RS13440 (M2921_13445) 71675..71869 + 195 WP_002367787.1 hypothetical protein -
M2921_RS13445 (M2921_13450) 71881..72072 + 192 WP_002367788.1 hypothetical protein -
M2921_RS13450 (M2921_13455) 72242..72457 + 216 WP_002367791.1 leucocin A/sakacin P family class II bacteriocin -
M2921_RS13455 (M2921_13460) 72458..72799 + 342 WP_002367792.1 bacteriocin immunity protein -
M2921_RS13460 (M2921_13465) 73215..73733 + 519 WP_002367793.1 hypothetical protein -
M2921_RS13465 (M2921_13470) 73681..73896 + 216 WP_002415356.1 hypothetical protein -
M2921_RS13470 (M2921_13475) 73988..74074 + 87 WP_012881081.1 type I toxin-antitoxin system Fst family toxin -
M2921_RS13475 (M2921_13480) 74331..74627 + 297 WP_002367795.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid cat / tet(L) / tet(M) / erm(B) / aph(3')-III / ant(6)-Ia / lnu(B) / lsa(E) / aac(6')-aph(2'') / dfrG - 1..102954 102954


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(7-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13244.44 Da        Isoelectric Point: 8.0113

>T244414 WP_002362432.1 NZ_CP097011:c69957-69616 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT244414 WP_002362431.1 NZ_CP097011:c70187-69957 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z2CGM4

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References