Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 69616..70187 | Replicon | plasmid pAT48-a |
| Accession | NZ_CP097011 | ||
| Organism | Enterococcus faecalis strain AT48 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A2Z2CGM4 |
| Locus tag | M2921_RS13415 | Protein ID | WP_002362432.1 |
| Coordinates | 69616..69957 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R3KHK9 |
| Locus tag | M2921_RS13420 | Protein ID | WP_002362431.1 |
| Coordinates | 69957..70187 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2921_RS13390 (M2921_13395) | 64630..65325 | - | 696 | WP_002405176.1 | Fic family protein | - |
| M2921_RS13395 (M2921_13400) | 65374..65973 | - | 600 | WP_002405175.1 | tyrosine-type recombinase/integrase | - |
| M2921_RS13405 (M2921_13410) | 67699..68301 | - | 603 | WP_002362434.1 | Fic family protein | - |
| M2921_RS13410 (M2921_13415) | 68566..69504 | - | 939 | WP_002362433.1 | hypothetical protein | - |
| M2921_RS13415 (M2921_13420) | 69616..69957 | - | 342 | WP_002362432.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| M2921_RS13420 (M2921_13425) | 69957..70187 | - | 231 | WP_002362431.1 | hypothetical protein | Antitoxin |
| M2921_RS13425 (M2921_13430) | 70391..71011 | + | 621 | WP_002367784.1 | recombinase family protein | - |
| M2921_RS13430 (M2921_13435) | 71001..71315 | + | 315 | WP_002367785.1 | hypothetical protein | - |
| M2921_RS13435 (M2921_13440) | 71309..71515 | + | 207 | WP_002367786.1 | hypothetical protein | - |
| M2921_RS13440 (M2921_13445) | 71675..71869 | + | 195 | WP_002367787.1 | hypothetical protein | - |
| M2921_RS13445 (M2921_13450) | 71881..72072 | + | 192 | WP_002367788.1 | hypothetical protein | - |
| M2921_RS13450 (M2921_13455) | 72242..72457 | + | 216 | WP_002367791.1 | leucocin A/sakacin P family class II bacteriocin | - |
| M2921_RS13455 (M2921_13460) | 72458..72799 | + | 342 | WP_002367792.1 | bacteriocin immunity protein | - |
| M2921_RS13460 (M2921_13465) | 73215..73733 | + | 519 | WP_002367793.1 | hypothetical protein | - |
| M2921_RS13465 (M2921_13470) | 73681..73896 | + | 216 | WP_002415356.1 | hypothetical protein | - |
| M2921_RS13470 (M2921_13475) | 73988..74074 | + | 87 | WP_012881081.1 | type I toxin-antitoxin system Fst family toxin | - |
| M2921_RS13475 (M2921_13480) | 74331..74627 | + | 297 | WP_002367795.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | cat / tet(L) / tet(M) / erm(B) / aph(3')-III / ant(6)-Ia / lnu(B) / lsa(E) / aac(6')-aph(2'') / dfrG | - | 1..102954 | 102954 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13244.44 Da Isoelectric Point: 8.0113
>T244414 WP_002362432.1 NZ_CP097011:c69957-69616 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2Z2CGM4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R3KHK9 |