Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) omega-epsilon-zeta/zeta-epsilon
Location 66216..67353 Replicon plasmid pAT50-a
Accession NZ_CP097009
Organism Enterococcus faecalis strain AT50

Toxin (Protein)


Gene name zeta Uniprot ID P0A4M2
Locus tag M2923_RS13145 Protein ID WP_002332783.1
Coordinates 66216..67079 (-) Length 288 a.a.

Antitoxin (Protein)


Gene name epsilon Uniprot ID Q9AL19
Locus tag M2923_RS13150 Protein ID WP_002326825.1
Coordinates 67081..67353 (-) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M2923_RS13115 (M2923_13115) 61603..62397 + 795 WP_001096887.1 aminoglycoside O-phosphotransferase APH(3')-IIIa -
M2923_RS13245 62807..62890 + 84 Protein_75 MLS leader peptide -
M2923_RS13120 (M2923_13120) 62939..63022 + 84 WP_001814874.1 23S rRNA methyltransferase attenuation leader peptide -
M2923_RS13125 (M2923_13125) 63147..63914 + 768 WP_172688991.1 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) -
M2923_RS13130 (M2923_13130) 63942..64622 + 681 WP_010713944.1 IS6-like element IS1216 family transposase -
M2923_RS13135 (M2923_13135) 64656..65162 - 507 WP_002415429.1 trimethoprim-resistant dihydrofolate reductase DfrG -
M2923_RS13140 (M2923_13140) 65459..65776 - 318 WP_002326830.1 hypothetical protein -
M2923_RS13145 (M2923_13145) 66216..67079 - 864 WP_002332783.1 zeta toxin family protein Toxin
M2923_RS13150 (M2923_13150) 67081..67353 - 273 WP_002326825.1 antitoxin Antitoxin
M2923_RS13155 (M2923_13155) 67371..67586 - 216 WP_001835296.1 peptide-binding protein -
M2923_RS13160 (M2923_13160) 67678..68574 - 897 WP_002326827.1 ParA family protein -
M2923_RS13165 (M2923_13165) 68677..68937 - 261 Protein_85 topoisomerase DNA-binding C4 zinc finger domain-containing protein -
M2923_RS13170 (M2923_13170) 69107..69844 - 738 WP_001038795.1 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) -
M2923_RS13175 (M2923_13175) 69969..70052 - 84 WP_001814874.1 23S rRNA methyltransferase attenuation leader peptide -
M2923_RS13250 70101..70184 - 84 Protein_88 MLS leader peptide -
M2923_RS13180 (M2923_13180) 70484..70855 - 372 WP_002358205.1 hypothetical protein -
M2923_RS13185 (M2923_13185) 70848..71693 - 846 WP_000239313.1 AAA family ATPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid cat / tet(L) / tet(M) / str / erm(A) / optrA / fexA / aph(3')-III / erm(B) / dfrG - 1..72164 72164
- inside IScluster/Tn erm(A) / optrA / fexA / aph(3')-III / erm(B) / dfrG - 47949..69844 21895


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Zeta toxin domain

(28-214)

Antitoxin

Bacterial epsilon antitoxin

(2-90)


Sequences

Toxin        


Download         Length: 288 a.a.        Molecular weight: 32675.27 Da        Isoelectric Point: 7.3939

>T244394 WP_002332783.1 NZ_CP097009:c67079-66216 [Enterococcus faecalis]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI

Download         Length: 864 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 10720.17 Da        Isoelectric Point: 4.4865

>AT244394 WP_002326825.1 NZ_CP097009:c67353-67081 [Enterococcus faecalis]
MAVTYEKTFEIEIINELSASVYNRVLNYVLNHELDTKNTRLLEVNLLNQLEVAQEVDLFQQPFEELQAIHEYWRSMNQYS
KQILTKEKVA

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB P0A4M2

Antitoxin

Source ID Structure
AlphaFold DB A0A0M2AF93

References