244393

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 41263..41834 Replicon plasmid pAT50-a
Accession NZ_CP097009
Organism Enterococcus faecalis strain AT50

Toxin (Protein)


Gene name mazF Uniprot ID A0A2Z2CGM4
Locus tag M2923_RS12975 Protein ID WP_002362432.1
Coordinates 41263..41604 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag M2923_RS12980 Protein ID WP_002362431.1
Coordinates 41604..41834 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M2923_RS12955 (M2923_12955) 36764..37612 + 849 WP_001258486.1 streptomycin adenylyltransferase Str -
M2923_RS12965 (M2923_12965) 39346..39948 - 603 WP_002362434.1 Fic family protein -
M2923_RS12970 (M2923_12970) 40213..41151 - 939 WP_002362433.1 hypothetical protein -
M2923_RS12975 (M2923_12975) 41263..41604 - 342 WP_002362432.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
M2923_RS12980 (M2923_12980) 41604..41834 - 231 WP_002362431.1 hypothetical protein Antitoxin
M2923_RS12985 (M2923_12985) 42038..42658 + 621 WP_002367784.1 recombinase family protein -
M2923_RS12990 (M2923_12990) 42648..42962 + 315 WP_002367785.1 hypothetical protein -
M2923_RS12995 (M2923_12995) 42956..43162 + 207 WP_002367786.1 hypothetical protein -
M2923_RS13000 (M2923_13000) 43322..43516 + 195 WP_002367787.1 hypothetical protein -
M2923_RS13005 (M2923_13005) 43528..43719 + 192 WP_002367788.1 hypothetical protein -
M2923_RS13010 (M2923_13010) 43889..44104 + 216 WP_002367791.1 leucocin A/sakacin P family class II bacteriocin -
M2923_RS13015 (M2923_13015) 44105..44446 + 342 WP_002367792.1 bacteriocin immunity protein -
M2923_RS13020 (M2923_13020) 44862..45380 + 519 WP_002367793.1 hypothetical protein -
M2923_RS13025 (M2923_13025) 45328..45543 + 216 WP_002415356.1 hypothetical protein -
M2923_RS13030 (M2923_13030) 45635..45721 + 87 WP_012881081.1 type I toxin-antitoxin system Fst family toxin -
M2923_RS13035 (M2923_13035) 45978..46274 + 297 WP_002367795.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid cat / tet(L) / tet(M) / str / erm(A) / optrA / fexA / aph(3')-III / erm(B) / dfrG - 1..72164 72164


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(7-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13244.44 Da        Isoelectric Point: 8.0113

>T244393 WP_002362432.1 NZ_CP097009:c41604-41263 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT244393 WP_002362431.1 NZ_CP097009:c41834-41604 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z2CGM4

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References