Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 41263..41834 | Replicon | plasmid pAT50-a |
| Accession | NZ_CP097009 | ||
| Organism | Enterococcus faecalis strain AT50 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A2Z2CGM4 |
| Locus tag | M2923_RS12975 | Protein ID | WP_002362432.1 |
| Coordinates | 41263..41604 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R3KHK9 |
| Locus tag | M2923_RS12980 | Protein ID | WP_002362431.1 |
| Coordinates | 41604..41834 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2923_RS12955 (M2923_12955) | 36764..37612 | + | 849 | WP_001258486.1 | streptomycin adenylyltransferase Str | - |
| M2923_RS12965 (M2923_12965) | 39346..39948 | - | 603 | WP_002362434.1 | Fic family protein | - |
| M2923_RS12970 (M2923_12970) | 40213..41151 | - | 939 | WP_002362433.1 | hypothetical protein | - |
| M2923_RS12975 (M2923_12975) | 41263..41604 | - | 342 | WP_002362432.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| M2923_RS12980 (M2923_12980) | 41604..41834 | - | 231 | WP_002362431.1 | hypothetical protein | Antitoxin |
| M2923_RS12985 (M2923_12985) | 42038..42658 | + | 621 | WP_002367784.1 | recombinase family protein | - |
| M2923_RS12990 (M2923_12990) | 42648..42962 | + | 315 | WP_002367785.1 | hypothetical protein | - |
| M2923_RS12995 (M2923_12995) | 42956..43162 | + | 207 | WP_002367786.1 | hypothetical protein | - |
| M2923_RS13000 (M2923_13000) | 43322..43516 | + | 195 | WP_002367787.1 | hypothetical protein | - |
| M2923_RS13005 (M2923_13005) | 43528..43719 | + | 192 | WP_002367788.1 | hypothetical protein | - |
| M2923_RS13010 (M2923_13010) | 43889..44104 | + | 216 | WP_002367791.1 | leucocin A/sakacin P family class II bacteriocin | - |
| M2923_RS13015 (M2923_13015) | 44105..44446 | + | 342 | WP_002367792.1 | bacteriocin immunity protein | - |
| M2923_RS13020 (M2923_13020) | 44862..45380 | + | 519 | WP_002367793.1 | hypothetical protein | - |
| M2923_RS13025 (M2923_13025) | 45328..45543 | + | 216 | WP_002415356.1 | hypothetical protein | - |
| M2923_RS13030 (M2923_13030) | 45635..45721 | + | 87 | WP_012881081.1 | type I toxin-antitoxin system Fst family toxin | - |
| M2923_RS13035 (M2923_13035) | 45978..46274 | + | 297 | WP_002367795.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | cat / tet(L) / tet(M) / str / erm(A) / optrA / fexA / aph(3')-III / erm(B) / dfrG | - | 1..72164 | 72164 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13244.44 Da Isoelectric Point: 8.0113
>T244393 WP_002362432.1 NZ_CP097009:c41604-41263 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2Z2CGM4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R3KHK9 |