Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 49935..50506 Replicon plasmid pLS05-1-a
Accession NZ_CP097007
Organism Enterococcus faecalis strain LS05-1

Toxin (Protein)


Gene name mazF Uniprot ID A0A2Z2CGM4
Locus tag M2924_RS12965 Protein ID WP_002362432.1
Coordinates 49935..50276 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag M2924_RS12970 Protein ID WP_002362431.1
Coordinates 50276..50506 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M2924_RS12945 (M2924_12945) 45334..46617 - 1284 Protein_52 hypothetical protein -
M2924_RS12955 (M2924_12955) 48018..48620 - 603 WP_002362434.1 Fic family protein -
M2924_RS12960 (M2924_12960) 48885..49823 - 939 WP_002362433.1 hypothetical protein -
M2924_RS12965 (M2924_12965) 49935..50276 - 342 WP_002362432.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
M2924_RS12970 (M2924_12970) 50276..50506 - 231 WP_002362431.1 hypothetical protein Antitoxin
M2924_RS12975 (M2924_12975) 50710..51330 + 621 WP_002367784.1 recombinase family protein -
M2924_RS12980 (M2924_12980) 51320..51634 + 315 WP_002367785.1 hypothetical protein -
M2924_RS12985 (M2924_12985) 51628..51834 + 207 WP_002367786.1 hypothetical protein -
M2924_RS12990 (M2924_12990) 51994..52188 + 195 WP_002367787.1 hypothetical protein -
M2924_RS12995 (M2924_12995) 52200..52391 + 192 WP_002367788.1 hypothetical protein -
M2924_RS13000 (M2924_13000) 52561..52776 + 216 WP_002367791.1 leucocin A/sakacin P family class II bacteriocin -
M2924_RS13005 (M2924_13005) 52777..53118 + 342 WP_002367792.1 bacteriocin immunity protein -
M2924_RS13010 (M2924_13010) 53534..54052 + 519 WP_002367793.1 hypothetical protein -
M2924_RS13015 (M2924_13015) 54000..54215 + 216 WP_002415356.1 hypothetical protein -
M2924_RS13020 (M2924_13020) 54307..54393 + 87 WP_012881081.1 type I toxin-antitoxin system Fst family toxin -
M2924_RS13025 (M2924_13025) 54650..54946 + 297 WP_002367795.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid cat / tet(L) / tet(M) / fexA / optrA / erm(B) - 1..59599 59599


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(7-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13244.44 Da        Isoelectric Point: 8.0113

>T244377 WP_002362432.1 NZ_CP097007:c50276-49935 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT244377 WP_002362431.1 NZ_CP097007:c50506-50276 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2Z2CGM4

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References