Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 49935..50506 | Replicon | plasmid pLS05-1-a |
| Accession | NZ_CP097007 | ||
| Organism | Enterococcus faecalis strain LS05-1 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A2Z2CGM4 |
| Locus tag | M2924_RS12965 | Protein ID | WP_002362432.1 |
| Coordinates | 49935..50276 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | R3KHK9 |
| Locus tag | M2924_RS12970 | Protein ID | WP_002362431.1 |
| Coordinates | 50276..50506 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2924_RS12945 (M2924_12945) | 45334..46617 | - | 1284 | Protein_52 | hypothetical protein | - |
| M2924_RS12955 (M2924_12955) | 48018..48620 | - | 603 | WP_002362434.1 | Fic family protein | - |
| M2924_RS12960 (M2924_12960) | 48885..49823 | - | 939 | WP_002362433.1 | hypothetical protein | - |
| M2924_RS12965 (M2924_12965) | 49935..50276 | - | 342 | WP_002362432.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| M2924_RS12970 (M2924_12970) | 50276..50506 | - | 231 | WP_002362431.1 | hypothetical protein | Antitoxin |
| M2924_RS12975 (M2924_12975) | 50710..51330 | + | 621 | WP_002367784.1 | recombinase family protein | - |
| M2924_RS12980 (M2924_12980) | 51320..51634 | + | 315 | WP_002367785.1 | hypothetical protein | - |
| M2924_RS12985 (M2924_12985) | 51628..51834 | + | 207 | WP_002367786.1 | hypothetical protein | - |
| M2924_RS12990 (M2924_12990) | 51994..52188 | + | 195 | WP_002367787.1 | hypothetical protein | - |
| M2924_RS12995 (M2924_12995) | 52200..52391 | + | 192 | WP_002367788.1 | hypothetical protein | - |
| M2924_RS13000 (M2924_13000) | 52561..52776 | + | 216 | WP_002367791.1 | leucocin A/sakacin P family class II bacteriocin | - |
| M2924_RS13005 (M2924_13005) | 52777..53118 | + | 342 | WP_002367792.1 | bacteriocin immunity protein | - |
| M2924_RS13010 (M2924_13010) | 53534..54052 | + | 519 | WP_002367793.1 | hypothetical protein | - |
| M2924_RS13015 (M2924_13015) | 54000..54215 | + | 216 | WP_002415356.1 | hypothetical protein | - |
| M2924_RS13020 (M2924_13020) | 54307..54393 | + | 87 | WP_012881081.1 | type I toxin-antitoxin system Fst family toxin | - |
| M2924_RS13025 (M2924_13025) | 54650..54946 | + | 297 | WP_002367795.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | cat / tet(L) / tet(M) / fexA / optrA / erm(B) | - | 1..59599 | 59599 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13244.44 Da Isoelectric Point: 8.0113
>T244377 WP_002362432.1 NZ_CP097007:c50276-49935 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2Z2CGM4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | R3KHK9 |