Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 64543..65114 Replicon plasmid pLS06-1-a
Accession NZ_CP097003
Organism Enterococcus faecalis strain LS06-1

Toxin (Protein)


Gene name mazF Uniprot ID S4H3R9
Locus tag M2926_RS12850 Protein ID WP_010784114.1
Coordinates 64543..64884 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag M2926_RS12855 Protein ID WP_002362431.1
Coordinates 64884..65114 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M2926_RS12830 (M2926_12830) 59942..61225 - 1284 WP_002362438.1 hypothetical protein -
M2926_RS12840 (M2926_12840) 62626..63228 - 603 WP_002362434.1 Fic family protein -
M2926_RS12845 (M2926_12845) 63493..64431 - 939 WP_002362433.1 hypothetical protein -
M2926_RS12850 (M2926_12850) 64543..64884 - 342 WP_010784114.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
M2926_RS12855 (M2926_12855) 64884..65114 - 231 WP_002362431.1 hypothetical protein Antitoxin
M2926_RS12860 (M2926_12860) 65318..65938 + 621 WP_002375379.1 recombinase family protein -
M2926_RS12865 (M2926_12865) 65955..66242 + 288 WP_085406799.1 hypothetical protein -
M2926_RS12870 (M2926_12870) 66236..66481 + 246 WP_116495280.1 ultraviolet resistance protein UvrA repressor UvrC -
M2926_RS12875 (M2926_12875) 66521..66730 + 210 WP_002363054.1 hypothetical protein -
M2926_RS12880 (M2926_12880) 66744..66902 + 159 Protein_77 recombinase family protein -
M2926_RS12885 (M2926_12885) 67071..67322 + 252 WP_010815874.1 hypothetical protein -
M2926_RS12890 (M2926_12890) 67377..67814 - 438 WP_116495281.1 hypothetical protein -
M2926_RS12895 (M2926_12895) 67906..68157 + 252 WP_010815876.1 hypothetical protein -
M2926_RS12900 (M2926_12900) 68273..69589 + 1317 WP_116495282.1 Y-family DNA polymerase -
M2926_RS12905 (M2926_12905) 69593..70108 + 516 WP_002394804.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid cat / tet(L) / tet(M) / ant(6)-Ia / aph(3')-III / erm(B) - 1..72603 72603
- inside IScluster/Tn ant(6)-Ia / aph(3')-III / erm(B) - 50676..59784 9108


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(7-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13270.47 Da        Isoelectric Point: 7.9750

>T244351 WP_010784114.1 NZ_CP097003:c64884-64543 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSAEKEIQKRRPGLVVSRYEFNRKTLFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFAERKLSQIEYLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT244351 WP_002362431.1 NZ_CP097003:c65114-64884 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S4H3R9

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References