Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
| Location | 57367..58504 | Replicon | plasmid pLS06-1-a |
| Accession | NZ_CP097003 | ||
| Organism | Enterococcus faecalis strain LS06-1 | ||
Toxin (Protein)
| Gene name | zeta | Uniprot ID | D1MAU9 |
| Locus tag | M2926_RS12820 | Protein ID | WP_002333464.1 |
| Coordinates | 57641..58504 (+) | Length | 288 a.a. |
Antitoxin (Protein)
| Gene name | epsilon | Uniprot ID | R2XCR7 |
| Locus tag | M2926_RS12815 | Protein ID | WP_000301765.1 |
| Coordinates | 57367..57639 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2926_RS12780 (M2926_12780) | 52698..53240 | + | 543 | WP_000627290.1 | streptothricin N-acetyltransferase Sat4 | - |
| M2926_RS12785 (M2926_12785) | 53333..54127 | + | 795 | WP_001096887.1 | aminoglycoside O-phosphotransferase APH(3')-IIIa | - |
| M2926_RS12990 | 54537..54620 | + | 84 | Protein_58 | MLS leader peptide | - |
| M2926_RS12790 (M2926_12790) | 54669..54752 | + | 84 | WP_117844860.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
| M2926_RS12795 (M2926_12795) | 54877..55614 | + | 738 | WP_002292226.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
| M2926_RS12800 (M2926_12800) | 55784..56044 | + | 261 | Protein_61 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
| M2926_RS12805 (M2926_12805) | 56147..57043 | + | 897 | WP_001809760.1 | ParA family protein | - |
| M2926_RS12810 (M2926_12810) | 57135..57350 | + | 216 | WP_002321610.1 | peptide-binding protein | - |
| M2926_RS12815 (M2926_12815) | 57367..57639 | + | 273 | WP_000301765.1 | antitoxin | Antitoxin |
| M2926_RS12820 (M2926_12820) | 57641..58504 | + | 864 | WP_002333464.1 | zeta toxin family protein | Toxin |
| M2926_RS12825 (M2926_12825) | 59098..59778 | - | 681 | WP_010710189.1 | IS6-like element IS1216 family transposase | - |
| M2926_RS12830 (M2926_12830) | 59942..61225 | - | 1284 | WP_002362438.1 | hypothetical protein | - |
| M2926_RS12840 (M2926_12840) | 62626..63228 | - | 603 | WP_002362434.1 | Fic family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | cat / tet(L) / tet(M) / ant(6)-Ia / aph(3')-III / erm(B) | - | 1..72603 | 72603 | |
| - | inside | IScluster/Tn | ant(6)-Ia / aph(3')-III / erm(B) | - | 50676..59784 | 9108 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32370.87 Da Isoelectric Point: 6.6610
>T244350 WP_002333464.1 NZ_CP097003:57641-58504 [Enterococcus faecalis]
MANIVNFTDKQFENRLNDNLEELVQGKKAVESPTAFLLGGQPGSGKTSLRSAILEETQGNVIVIDNDTFKQQHPNFDELA
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGL
MANIVNFTDKQFENRLNDNLEELVQGKKAVESPTAFLLGGQPGSGKTSLRSAILEETQGNVIVIDNDTFKQQHPNFDELA
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGL
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | D1MAU9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 3Q8X | |
| PDB | 1GVN | |
| AlphaFold DB | A0A829F0A3 |