Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
| Location | 2564676..2565247 | Replicon | chromosome |
| Accession | NZ_CP097002 | ||
| Organism | Enterococcus faecalis strain LS06-1 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | M2926_RS12045 | Protein ID | WP_002354774.1 |
| Coordinates | 2564676..2565017 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S4CGQ1 |
| Locus tag | M2926_RS12050 | Protein ID | WP_002367500.1 |
| Coordinates | 2565017..2565247 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M2926_RS12040 (2560691) | 2560691..2564305 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
| M2926_RS12045 (2564676) | 2564676..2565017 | - | 342 | WP_002354774.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| M2926_RS12050 (2565017) | 2565017..2565247 | - | 231 | WP_002367500.1 | hypothetical protein | Antitoxin |
| M2926_RS12055 (2565577) | 2565577..2565792 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
| M2926_RS12060 (2565931) | 2565931..2566923 | + | 993 | WP_002358973.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| M2926_RS12065 (2567187) | 2567187..2567825 | - | 639 | WP_002378863.1 | lytic polysaccharide monooxygenase | - |
| M2926_RS12070 (2568512) | 2568512..2570128 | + | 1617 | WP_010715485.1 | phosphatase PAP2/LCP family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13156.40 Da Isoelectric Point: 9.3984
>T244349 WP_002354774.1 NZ_CP097002:c2565017-2564676 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETQGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|